DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment out and SLC16A2

DIOPT Version :9

Sequence 1:NP_001285435.1 Gene:out / 32926 FlyBaseID:FBgn0259834 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_006508.2 Gene:SLC16A2 / 6567 HGNCID:10923 Length:539 Species:Homo sapiens


Alignment Length:202 Identity:48/202 - (23%)
Similarity:84/202 - (41%) Gaps:22/202 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FVAPDGGWGWVVCLAAGLNNFFLFPALQQYGLIYRVRMQ-------SLGFDAKQTTTI-VNVVMA 92
            |..|:||:||||..||...|..:|......|::|.:.::       .:.|.|.....: :.::..
Human    92 FQPPEGGFGWVVVFAATWCNGSIFGIHNSVGILYSMLLEEEKEKNRQVEFQAAWVGALAMGMIFF 156

  Fly    93 ISSLVGIVNGAMFRRFTFRQVALTGTSLAFLGVFLSAFCTTFWQYIICLSAIFGIGLGLAMAATS 157
            .|.:|.|....:..|.|    |..|.::||:|:..|:|.::..........:||.|...|...:.
Human   157 CSPIVSIFTDRLGCRIT----ATAGAAVAFIGLHTSSFTSSLSLRYFTYGILFGCGCSFAFQPSL 217

  Fly   158 LAVNTYFKLKRRRATGFSWTITGLGPIFFPQVSTVLLGYYG-----AQGTILIYAGIAMNAILCA 217
            :.:..||    :|..|.:..:...|...|......|:...|     || |..:.:......:|.:
Human   218 VILGHYF----QRRLGLANGVVSAGSSIFSMSFPFLIRMLGDKIKLAQ-TFQVLSTFMFVLMLLS 277

  Fly   218 LTLQPVL 224
            ||.:|:|
Human   278 LTYRPLL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
outNP_001285435.1 MFS 45..>225 CDD:119392 43/193 (22%)
MFS <464..621 CDD:119392
MFS_1 468..>621 CDD:284993
SLC16A2NP_006508.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..92 48/202 (24%)
2A0113 86..513 CDD:273325 48/202 (24%)
MFS 101..498 CDD:119392 43/193 (22%)
DUF1564 <286..>334 CDD:284922
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 508..539
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145512
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.