DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment out and si:dkey-246g23.4

DIOPT Version :9

Sequence 1:NP_001285435.1 Gene:out / 32926 FlyBaseID:FBgn0259834 Length:655 Species:Drosophila melanogaster
Sequence 2:XP_005169996.1 Gene:si:dkey-246g23.4 / 559426 ZFINID:ZDB-GENE-050419-234 Length:457 Species:Danio rerio


Alignment Length:315 Identity:71/315 - (22%)
Similarity:117/315 - (37%) Gaps:38/315 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RDKSDLGPDFVAPDGGWGWVVCLAAGLNNFFLFPALQQYGLIYRVRMQSLGFDAKQTTTIVNVVM 91
            |.:...||.....|||:||.:.|:..|.....|..::.:|:.:..........|..::.|.::.:
Zfish     3 RKRGTAGPAGPPLDGGYGWFIVLSTFLVFGLTFGVIKSFGVFFVEIHHYFSTTATASSWITSISV 67

  Fly    92 AISSLVGIVNGAMFRRFTFRQVALTGTSLAFLGVFLSAFCTTFWQYIICLSAIFGIGLGLAMAAT 156
            |...:...|..|:...|..|.|.:.|..|:.:|:.|.:|.....|..|.:..:.|.|..|....|
Zfish    68 ATVHIGAPVGSALSTYFGHRPVVMAGGLLSSVGMVLGSFAQDLLQLYITVGFLTGFGYALTWTPT 132

  Fly   157 SLAVNTYFKLKRRRATGFSWTITGLGPIFFPQVSTVLLGYYGAQGTILIYAGIAMNAILCALTLQ 221
            ...:..||..:|..|...|.|...|..........:::..:..:|.:||...:.:|..:|...|:
Zfish   133 VTMLGWYFDKRRPVANALSSTGECLLTFILTPSFQLMVDQFSWRGAMLILGALQLNLCVCGALLR 197

  Fly   222 PVLWH--VKKPEKPVHNTIEGIAETEKLQPELLEANGNLLSPSNDPWKDYECKYCQY-------- 276
            |:..|  .|          :.|.|.|.   ||.:.:.|  ...:||.|....:|..|        
Zfish   198 PLSRHDYFK----------DSIEENEH---ELSKCSNN--RADSDPMKVKVIRYVDYTLIANSRF 247

  Fly   277 QKRSKRGLFS-----SQYLFNVDDPERPGYEITEPGTPM--------LARANDGW 318
            ...|..|:|:     :..||.|......|.|..:..:.|        |.|...||
Zfish   248 MVYSMFGIFAALGFFAPSLFLVPYARSQGVEEYQAASLMSISAVLDLLGRVFFGW 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
outNP_001285435.1 MFS 45..>225 CDD:119392 38/179 (21%)
MFS <464..621 CDD:119392
MFS_1 468..>621 CDD:284993
si:dkey-246g23.4XP_005169996.1 2A0111 10..446 CDD:331689 69/308 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578801
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X70
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.