DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment out and slc16a3b

DIOPT Version :9

Sequence 1:NP_001285435.1 Gene:out / 32926 FlyBaseID:FBgn0259834 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_997873.1 Gene:slc16a3b / 327276 ZFINID:ZDB-GENE-030131-5487 Length:508 Species:Danio rerio


Alignment Length:226 Identity:61/226 - (26%)
Similarity:102/226 - (45%) Gaps:8/226 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DKSDLGPDFVAPDGGWGWVVCLAAGLNNFFLFPALQQYGLIYRVRMQSLGFDAKQTTTIVNVVMA 92
            |..|.|  ..||||||||.|.....:...|.:...:...:.::..::..|.....|..|.::::|
Zfish     7 DTGDSG--VKAPDGGWGWAVLFGCFIITGFSYAFPKAVSVFFKELIREFGVGYSDTAWISSILLA 69

  Fly    93 ISSLVGIVNGAMFRRFTFRQVALTGTSLAFLGVFLSAFCTTFWQYIICLSAIFGIGLGLAMAATS 157
            :....|.:...:..||..|.|.:.|...|.||:.|::|.|......:|...|.|:||.|....:.
Zfish    70 MLYGTGPLCSILVNRFGCRPVMMVGGLFASLGMVLASFATNIIHIYLCTGVITGLGLALNFQPSL 134

  Fly   158 LAVNTYFKLKRRRATGFSWTITGLGPIFFPQVSTVLLGYYGAQGTILIYAGIAMNAILCALTLQP 222
            :.:|.||..||..|.|.:...:.:.......:..||...||.:|..||..|:.:|...|...::|
Zfish   135 IMLNRYFSEKRPLANGLAAAGSPVALCCLSPLGQVLQYKYGWRGGFLILGGLLLNCCACGALMRP 199

  Fly   223 VLWHVKKPEKPVHNTIEGIAETEKLQPELLE 253
            :|    .|:|.  :.:|...:..|.:|:||:
Zfish   200 LL----APKKT--SEVEEKPKETKPKPKLLD 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
outNP_001285435.1 MFS 45..>225 CDD:119392 43/179 (24%)
MFS <464..621 CDD:119392
MFS_1 468..>621 CDD:284993
slc16a3bNP_997873.1 MFS 22..410 CDD:119392 51/209 (24%)
MFS_1 25..376 CDD:284993 49/206 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578826
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11360
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X70
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.