DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment out and slcf-1

DIOPT Version :9

Sequence 1:NP_001285435.1 Gene:out / 32926 FlyBaseID:FBgn0259834 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_509762.2 Gene:slcf-1 / 186633 WormBaseID:WBGene00010340 Length:450 Species:Caenorhabditis elegans


Alignment Length:219 Identity:54/219 - (24%)
Similarity:90/219 - (41%) Gaps:56/219 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 VRMQSLGFDAKQ-------TTTIVN--VVMAISSLVGIVNG-AMFRRFTFRQVALTGTSLAFLGV 125
            :.|:|...:.|:       .|:|..  |:..:.||..:.|| .|...:...|::|:.        
 Worm   261 ILMESENIEDKEILYGYQGLTSIAGKFVLTFVMSLNKVHNGIIMILSYVIAQLSLSA-------- 317

  Fly   126 FLSAFCTTFWQYIICLSAIFGIGLGLAMAATS-LAVNTYFKLKRRRATGFSWTITGLGPIFFPQV 189
              :|||..|||:.: .:|..|||:||..|..: ..|......:...|.||:..|.|:..|     
 Worm   318 --AAFCYKFWQFRL-QNAFAGIGIGLYQACLAPFLVALVGPSQLAYALGFTNLINGVSII----- 374

  Fly   190 STVLLGYYGAQGT----------ILIYAGIAMNAILCALTLQPVLW----HVKKPE-KPVHNTIE 239
            |.|.:..:.::||          :.|:.|:|  ||:.::....||.    |.:||. |.:.::.|
 Worm   375 SGVWISGFASKGTTGDHARSAFFVSIWLGLA--AIVMSIATSSVLMAREKHKRKPSMKQMKHSSE 437

  Fly   240 GIAETEKLQPELLEANGNLLSPSN 263
                        |.|..|:.|..|
 Worm   438 ------------LNALTNITSVEN 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
outNP_001285435.1 MFS 45..>225 CDD:119392 43/174 (25%)
MFS <464..621 CDD:119392
MFS_1 468..>621 CDD:284993
slcf-1NP_509762.2 MFS 44..410 CDD:119392 42/166 (25%)
MFS_1 79..376 CDD:284993 33/130 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.