Sequence 1: | NP_001285435.1 | Gene: | out / 32926 | FlyBaseID: | FBgn0259834 | Length: | 655 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001357478.1 | Gene: | SLC16A11 / 162515 | HGNCID: | 23093 | Length: | 447 | Species: | Homo sapiens |
Alignment Length: | 201 | Identity: | 57/201 - (28%) |
---|---|---|---|
Similarity: | 85/201 - (42%) | Gaps: | 4/201 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 GPDFVAPDGGWGWVVCLAAGLNNFFLFPALQQYGLIYRVRMQSLGFDAKQTTTIVNVVMAISSLV 97
Fly 98 GIVNGAMFRRFTFRQVALTGTSLAFLGVFLSAFCTTFWQYIICLSAIFGIGLGLAMAATSLAVNT 162
Fly 163 YFKLKRRRATGFSWTITGLGPIFFPQVSTVLLGYYGAQGTILIYAGIAMNAILCALTLQPVLWHV 227
Fly 228 KKPEKP 233 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
out | NP_001285435.1 | MFS | 45..>225 | CDD:119392 | 47/179 (26%) |
MFS | <464..621 | CDD:119392 | |||
MFS_1 | 468..>621 | CDD:284993 | |||
SLC16A11 | NP_001357478.1 | MFS | 14..403 | CDD:355786 | 50/190 (26%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165145503 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0.891027 | Normalized mean entropy | S3509 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D916876at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X70 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.800 |