DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment out and SLC16A11

DIOPT Version :9

Sequence 1:NP_001285435.1 Gene:out / 32926 FlyBaseID:FBgn0259834 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001357478.1 Gene:SLC16A11 / 162515 HGNCID:23093 Length:447 Species:Homo sapiens


Alignment Length:201 Identity:57/201 - (28%)
Similarity:85/201 - (42%) Gaps:4/201 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GPDFVAPDGGWGWVVCLAAGLNNFFLFPALQQYGLIYRVRMQSLGFDAKQTTTIVNVVMAISSLV 97
            ||    |||||||||..||...|...:..|:..||.:....:.....|:.|..|..:.:|:....
Human     7 GP----PDGGWGWVVAAAAFAINGLSYGLLRSLGLAFPDLAEHFDRSAQDTAWISALALAVQQAA 67

  Fly    98 GIVNGAMFRRFTFRQVALTGTSLAFLGVFLSAFCTTFWQYIICLSAIFGIGLGLAMAATSLAVNT 162
            ..|..|:..|:..|.|.:.|..||.||...|||.:......:.|..:.|.|..|..|.....::.
Human    68 SPVGSALSTRWGARPVVMVGGVLASLGFVFSAFASDLLHLYLGLGLLAGFGWALVFAPALGTLSR 132

  Fly   163 YFKLKRRRATGFSWTITGLGPIFFPQVSTVLLGYYGAQGTILIYAGIAMNAILCALTLQPVLWHV 227
            ||..:|..|.|.:.|..|...:.......:||..:|.:|.:|:...|.::...|...|.|::...
Human   133 YFSRRRVLAVGLALTGNGASSLLLAPALQLLLDTFGWRGALLLLGAITLHLTPCGALLLPLVLPG 197

  Fly   228 KKPEKP 233
            ..|..|
Human   198 DPPAPP 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
outNP_001285435.1 MFS 45..>225 CDD:119392 47/179 (26%)
MFS <464..621 CDD:119392
MFS_1 468..>621 CDD:284993
SLC16A11NP_001357478.1 MFS 14..403 CDD:355786 50/190 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145503
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.891027 Normalized mean entropy S3509
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X70
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.