DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment out and SLC16A10

DIOPT Version :9

Sequence 1:NP_001285435.1 Gene:out / 32926 FlyBaseID:FBgn0259834 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_061063.2 Gene:SLC16A10 / 117247 HGNCID:17027 Length:515 Species:Homo sapiens


Alignment Length:221 Identity:50/221 - (22%)
Similarity:90/221 - (40%) Gaps:20/221 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TTKPKKPKRRDKSDLGPDFVAPDGGWGWVVCLAAGLNNFFLFPALQQYGLIYRVRMQSLGFDAKQ 82
            |.:|.:|         |:  .|:|||||:|.|||...|..:|......|:::...:::.|  :|.
Human    55 TAEPHEP---------PE--PPEGGWGWLVMLAAMWCNGSVFGIQNACGVLFVSMLETFG--SKD 106

  Fly    83 TTTIVNVVMAISSL-VGI------VNGAMFRRFTFRQVALTGTSLAFLGVFLSAFCTTFWQYIIC 140
            ...:|.....:.|| :|:      :.......|..|:.|:.|.::.|:|:..|:|.::.....:.
Human   107 DDKMVFKTAWVGSLSMGMIFFCCPIVSVFTDLFGCRKTAVVGAAVGFVGLMSSSFVSSIEPLYLT 171

  Fly   141 LSAIFGIGLGLAMAATSLAVNTYFKLKRRRATGFSWTITGLGPIFFPQVSTVLLGYYGAQGTILI 205
            ...||..|...|...:.:.:..|||.:.....|.....:.:..|..|.:..||:...|...|:.:
Human   172 YGIIFACGCSFAYQPSLVILGHYFKKRLGLVNGIVTAGSSVFTILLPLLLRVLIDSVGLFYTLRV 236

  Fly   206 YAGIAMNAILCALTLQPVLWHVKKPE 231
            .........|...|.:|:....|..|
Human   237 LCIFMFVLFLAGFTYRPLATSTKDKE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
outNP_001285435.1 MFS 45..>225 CDD:119392 39/186 (21%)
MFS <464..621 CDD:119392
MFS_1 468..>621 CDD:284993
SLC16A10NP_061063.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48
2A0113 67..487 CDD:273325 45/198 (23%)
MFS 71..470 CDD:119392 41/194 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145497
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.