DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment out and slc16a2

DIOPT Version :9

Sequence 1:NP_001285435.1 Gene:out / 32926 FlyBaseID:FBgn0259834 Length:655 Species:Drosophila melanogaster
Sequence 2:XP_031747020.1 Gene:slc16a2 / 100494635 XenbaseID:XB-GENE-980579 Length:499 Species:Xenopus tropicalis


Alignment Length:235 Identity:59/235 - (25%)
Similarity:96/235 - (40%) Gaps:22/235 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PKRRDKSDLGPDFVAPDGGWGWVVCLAAGLNNFFLFPALQQYGLIYRVRMQ-------SLGFDAK 81
            |.:|::...|.   .|:||:||||.|||...:..:|.....:|:|| |.:|       ..|.|.|
 Frog    40 PGKREEDGRGR---VPEGGFGWVVVLAATWCSGSIFGIQNSFGIIY-VMLQGEMDGTEEQGMDFK 100

  Fly    82 QTTTIVNVVMAISSLVGIVNGAMFRRFTFRQVALTGTSLAFLGVFLSAFCTTFWQYIICLSAIFG 146
             |..:.::.|.:......|......|...|:.:..|.:|||:|:..|:|..:..........:||
 Frog   101 -TAWVGSLAMGMIFFCSPVVSIFTDRLGCRKTSSGGAALAFIGLLSSSFTKSLGVRYFTYGILFG 164

  Fly   147 IGLGLAMAATSLAVNTYFKLKRRRATGFSWTITGLGPIF---FPQVSTVLLGYYGAQGTILIYAG 208
            .|...|...:.:.:..|||.:.....|.   :.|...:|   .|.:..::.|..|.|.|..:.:.
 Frog   165 CGCSFAFQPSLVILGHYFKKRLGLVNGI---VAGGSCVFTMCLPFLLKMMGGAIGLQHTFQVLSV 226

  Fly   209 IAMNAILCALTLQPVLWHVKKPEKPVHNTIEGIAETEKLQ 248
            .....|..:||.:|:|    .|........|.:|...|.|
 Frog   227 FMFIQIFLSLTFKPLL----PPPVDFSKEKEKVAGRSKAQ 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
outNP_001285435.1 MFS 45..>225 CDD:119392 46/189 (24%)
MFS <464..621 CDD:119392
MFS_1 468..>621 CDD:284993
slc16a2XP_031747020.1 MFS_MCT8 57..459 CDD:341023 53/215 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.