DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8051 and Slc16a11

DIOPT Version :9

Sequence 1:NP_001285434.1 Gene:CG8051 / 32925 FlyBaseID:FBgn0031012 Length:616 Species:Drosophila melanogaster
Sequence 2:XP_038941393.1 Gene:Slc16a11 / 287450 RGDID:1311125 Length:593 Species:Rattus norvegicus


Alignment Length:246 Identity:66/246 - (26%)
Similarity:102/246 - (41%) Gaps:28/246 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PE--EQAEQLLPKNGSAGQTK---IAPPTHTHSIAAASVPQKVPAKKKRDKSDLGEDFVAPDGGW 84
            ||  .|..| ||..|...:|.   ::||..|     |..|:  ||.             .|||||
  Rat   116 PEAGSQGRQ-LPSRGPGVETSFTGVSPPQQT-----AMTPK--PAG-------------PPDGGW 159

  Fly    85 GWLVSVAS-GVNILVTFALAQQFGILFRDRMAGLGISSSELTTIINTQIAVSAFTGLLNGPLFRR 148
            ||:|:.|: .||.| ::.|.:..|:...|.......|:.:...:....:||......:...|..|
  Rat   160 GWVVAAAAFAVNGL-SYGLLRSLGLALPDLAEHFERSAQDTAWVSALALAVQQAASPVGSALSTR 223

  Fly   149 YTYRVVALVGSVLTFLGLFWMVFADTFAVYIMSFSILYGFGRGLTVSASSLAVNTYFKVKRRTAT 213
            :..|.|.:||.|||.|||.:..||.:.....:...:|.|.|..|..:.:...::.||..:|..|.
  Rat   224 WGARPVVMVGGVLTSLGLVFSAFARSLLHLYLGLGLLAGSGWALVFAPALGTLSRYFSRRRVLAV 288

  Fly   214 AFQFGVAGLGPIVCPYFATYMLYEFGVQGTTLLFAGASLHTIACSLIYQPV 264
            .......|...::......::|..||.:|..||....:||...|..:.:|:
  Rat   289 GLALTGNGASSLLLAPALQFLLDTFGWRGALLLLGAVTLHLTPCGALLRPL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8051NP_001285434.1 MFS 86..>266 CDD:119392 45/180 (25%)
MFS <428..598 CDD:119392
MFS_1 440..>572 CDD:284993
Slc16a11XP_038941393.1 PHA03378 <42..158 CDD:223065 17/62 (27%)
MFS_MCT11_13 160..549 CDD:340981 46/181 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339193
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X70
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.