DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8051 and F10G7.5

DIOPT Version :9

Sequence 1:NP_001285434.1 Gene:CG8051 / 32925 FlyBaseID:FBgn0031012 Length:616 Species:Drosophila melanogaster
Sequence 2:NP_001359987.1 Gene:F10G7.5 / 173806 WormBaseID:WBGene00017369 Length:471 Species:Caenorhabditis elegans


Alignment Length:234 Identity:55/234 - (23%)
Similarity:91/234 - (38%) Gaps:68/234 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 WLVSVASGVNILVTFALAQQFGILFRDRMAGLGISSSELTTIINTQIAVSAFTGLLNGPLFRRYT 150
            :|....:.|.:.:|..|.:.:|..|.|....|.:..| :::|.|....|  |.|.:......:::
 Worm   272 FLSLTCNAVWVQLTSGLYKAYGQQFIDSDFFLSLIGS-ISSIFNAGSRV--FWGAIADTTSYQFS 333

  Fly   151 YRVVALVGSVLTF-LGLFWMVFAD----------------TFAV--YI-------MSFSILYGFG 189
            ..:|..:|:||.| :.|..||..|                ||::  ||       .:||::|||.
 Worm   334 MSIVCSLGAVLAFSMPLVKMVSNDVLFLATVCLMFSCIGGTFSIFPYITHKCFSKANFSVMYGFL 398

  Fly   190 RGLTVSASSLAVNTYFKVKRRTATAFQFGVAGLGPIVCPYFATYMLYEFGVQGTTLLFAGASLHT 254
            : ..||.:.|                   :|||       .:|:.|.|.|.:...::.....|.:
 Worm   399 Q-CAVSVAGL-------------------IAGL-------ISTHALSEIGFEYLFIVCGCFMLTS 436

  Fly   255 IACSLIYQPVKWHVVKRDRDAEALQQVQPLAEREDQDED 293
            :..:.|       |.|.|     |.|:...||||..:||
 Worm   437 LFLTFI-------VHKTD-----LAQLLVSAEREHLEED 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8051NP_001285434.1 MFS 86..>266 CDD:119392 44/205 (21%)
MFS <428..598 CDD:119392
MFS_1 440..>572 CDD:284993
F10G7.5NP_001359987.1 2A0111 30..439 CDD:273323 43/196 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.