DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8051 and SLC16A11

DIOPT Version :9

Sequence 1:NP_001285434.1 Gene:CG8051 / 32925 FlyBaseID:FBgn0031012 Length:616 Species:Drosophila melanogaster
Sequence 2:NP_001357478.1 Gene:SLC16A11 / 162515 HGNCID:23093 Length:447 Species:Homo sapiens


Alignment Length:186 Identity:51/186 - (27%)
Similarity:80/186 - (43%) Gaps:2/186 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PDGGWGWLVSVAS-GVNILVTFALAQQFGILFRDRMAGLGISSSELTTIINTQIAVSAFTGLLNG 143
            |||||||:|:.|: .:|.| ::.|.:..|:.|.|.......|:.:...|....:||......:..
Human     9 PDGGWGWVVAAAAFAINGL-SYGLLRSLGLAFPDLAEHFDRSAQDTAWISALALAVQQAASPVGS 72

  Fly   144 PLFRRYTYRVVALVGSVLTFLGLFWMVFADTFAVYIMSFSILYGFGRGLTVSASSLAVNTYFKVK 208
            .|..|:..|.|.:||.||..||..:..||.......:...:|.|||..|..:.:...::.||..:
Human    73 ALSTRWGARPVVMVGGVLASLGFVFSAFASDLLHLYLGLGLLAGFGWALVFAPALGTLSRYFSRR 137

  Fly   209 RRTATAFQFGVAGLGPIVCPYFATYMLYEFGVQGTTLLFAGASLHTIACSLIYQPV 264
            |..|........|...::.......:|..||.:|..||....:||...|..:..|:
Human   138 RVLAVGLALTGNGASSLLLAPALQLLLDTFGWRGALLLLGAITLHLTPCGALLLPL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8051NP_001285434.1 MFS 86..>266 CDD:119392 45/180 (25%)
MFS <428..598 CDD:119392
MFS_1 440..>572 CDD:284993
SLC16A11NP_001357478.1 MFS 14..403 CDD:355786 46/181 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145502
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X70
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.