DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8034 and SLC16A3

DIOPT Version :9

Sequence 1:NP_573376.2 Gene:CG8034 / 32924 FlyBaseID:FBgn0031011 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001035887.1 Gene:SLC16A3 / 9123 HGNCID:10924 Length:465 Species:Homo sapiens


Alignment Length:477 Identity:115/477 - (24%)
Similarity:179/477 - (37%) Gaps:106/477 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 APDGGWGWVACFGVSLVNLATRSIEPSFGLLFGDTLKELNVGTTGAAVIISALDVCMNFSGLFVG 74
            ||||||||...||..::...:.:...:..:.|.:.::|..:|.:..|.|.|.|...:..:|....
Human    15 APDGGWGWAVLFGCFVITGFSYAFPKAVSVFFKELIQEFGIGYSDTAWISSILLAMLYGTGPLCS 79

  Fly    75 PLLKEFSYRKVAIAGSLLCGLGLALTSPATSMAHILSTYSVINGIGVGLSTSAAFVALNHYFKHK 139
            ..:..|..|.|.:.|.|...||:...|...|:..:..|..||.|:|:.|:...:.:.||.||..:
Human    80 VCVNRFGCRPVMLVGGLFASLGMVAASFCRSIIQVYLTTGVITGLGLALNFQPSLIMLNRYFSKR 144

  Fly   140 RGQAVGLSMAGTAMGMLIMPQLVRILLEAYDFRGAVLLLAGVALNATVGSVLLQPVKWHMKEEFD 204
            |..|.||:.||:.:.:..:..|.::|.:.|.:||..|:|.|:.||..|.:.|::|          
Human   145 RPMANGLAAAGSPVFLCALSPLGQLLQDRYGWRGGFLILGGLLLNCCVCAALMRP---------- 199

  Fly   205 DEELMCISALP---TPQP-----QLTVGGAGG------AASAGA------PVFKV--IKEDGNEE 247
                :.::|.|   .|:|     .|:|....|      |||...      |||.|  .|:.|..:
Human   200 ----LVVTAQPGSGPPRPSRRLLDLSVFRDRGFVLYAVAASVMVLGLFVPPVFVVSYAKDLGVPD 260

  Fly   248 DALPEMNTLLFHKPHPHQHSMRKNYSEMAMNTMNGSRLGIPK-RP----TFPRIMSLAGVQSAAH 307
            .....:.|:|             .:.::......|...|:.| ||    .|...|...|:...|.
Human   261 TKAAFLLTIL-------------GFIDIFARPAAGFVAGLGKVRPYSVYLFSFSMFFNGLADLAG 312

  Fly   308 GAGGDSGGYT--------SQAEVNATQLRCRKASV------------------------TSNLSY 340
            ...||.||..        |...|.|.|.....|.|                        .|....
Human   313 STAGDYGGLVVFCIFFGISYGMVGALQFEVLMAIVGTHKFSSAIGLVLLMEAVAVLVGPPSGGKL 377

  Fly   341 MDFTGSILQVHLNTGDDEFEQNDRELRRVGTATGSIVLGGHRDSFIKMKPTELDKQAEAAAALDE 405
            :|.|...:.|.:..|.:             ..|.|::|.......|:.||.|  .|.|.|||.:|
Human   378 LDATHVYMYVFILAGAE-------------VLTSSLILLLGNFFCIRKKPKE--PQPEVAAAEEE 427

  Fly   406 EAKKKAKKPGFWRRFADLLDID 427
            :..|.....|     .||.:::
Human   428 KLHKPPADSG-----VDLREVE 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8034NP_573376.2 MFS 20..>197 CDD:119392 48/176 (27%)
MFS <437..583 CDD:119392
MFS_1 437..>581 CDD:284993
SLC16A3NP_001035887.1 2A0111 8..444 CDD:331689 115/475 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..438 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11360
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.