DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8034 and ESBP6

DIOPT Version :9

Sequence 1:NP_573376.2 Gene:CG8034 / 32924 FlyBaseID:FBgn0031011 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_014274.1 Gene:ESBP6 / 855598 SGDID:S000005069 Length:673 Species:Saccharomyces cerevisiae


Alignment Length:233 Identity:60/233 - (25%)
Similarity:97/233 - (41%) Gaps:49/233 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KVAPDGGWGWVACFGVSLVNLATRSIEPSFGLLFGDTLKELNVGT-TGAA----VIISALDVCMN 67
            ::.||||:|||..|.|.|...:|.....|||:   |....||..| .||:    .:|:.|.|   
Yeast   204 ELPPDGGYGWVVTFCVFLTMFSTWGCNASFGV---DLAYYLNHDTYPGASKYDYALIAGLTV--- 262

  Fly    68 FSGLFVGPLLKEFSYRKVAIAGSLLCGLGLALTSPATSMAHILSTYS-------VINGIGVGLST 125
            |.|..:.||:... .|.:.:..::|.|..:.|.      |::|::::       |..|..||.|.
Yeast   263 FLGQLLSPLVMAL-MRIIGLRTTMLFGDAVMLA------AYLLASFTTKLWQLYVTQGFMVGCSI 320

  Fly   126 SAAFV----ALNHYFKHKRGQAVGLSMAGTAMGMLIMPQLVRILLEAYDFRGAVLLLAGVALNAT 186
            |..||    .|..:|..||..|:|:|:.||..|.::.......:|..:......|.:.|::.:.:
Yeast   321 SLIFVPATTVLPGWFLKKRAVAMGVSLLGTGAGGVVYGLATNKMLSDFGNTRWCLRIIGISCSIS 385

  Fly   187 VGSVLLQPVKWHMKEEFDDEELMCISALPTPQPQLTVG 224
            |                    |:.|:.|....|...:|
Yeast   386 V--------------------LVAIALLKERNPTPAIG 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8034NP_573376.2 MFS 20..>197 CDD:119392 48/192 (25%)
MFS <437..583 CDD:119392
MFS_1 437..>581 CDD:284993
ESBP6NP_014274.1 MFS_MCT_SLC16 212..606 CDD:340910 56/225 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I2686
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm13433
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11360
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.