DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8034 and MCH5

DIOPT Version :9

Sequence 1:NP_573376.2 Gene:CG8034 / 32924 FlyBaseID:FBgn0031011 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_014951.4 Gene:MCH5 / 854483 SGDID:S000005833 Length:521 Species:Saccharomyces cerevisiae


Alignment Length:227 Identity:56/227 - (24%)
Similarity:96/227 - (42%) Gaps:26/227 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PDGGW-GWVACFGVSLVNLATRSIEPSFGL----LFGDTLKELNVGTTGAAVIISALDVCMNFSG 70
            |:||: .||..||..|..:|...:..|.|:    |..:.|...:|.|.|....: .|.|| :.|.
Yeast   100 PEGGFKAWVVTFGCFLGLIACFGLLNSTGVIESHLQDNQLSSESVSTIGWLFSL-FLFVC-SASC 162

  Fly    71 LFVGPLLKEFSYRKVAIAGSLLCGLGLALTSPATSMAHILSTYSVINGIGVGLSTSAAFVALNHY 135
            :..|.......:|.:.|.|::....||..|:.:|...|.:.:::::.|.|.|:..|.......||
Yeast   163 IISGTYFDRNGFRTIMIVGTVFHVAGLFATANSTKYWHFILSFAIVCGFGNGIVLSPLVSVPAHY 227

  Fly   136 FKHKRGQAVGLSMAGTAMGMLIMPQLVRILLE-------AYDFRGAVLLLAGVALN-ATVGSVLL 192
            |..:||.|:.::..|.::|.::.|.::|....       .|.|...:..|..:.|. .|:..:|:
Yeast   228 FFKRRGTALAMATIGGSVGGVVFPIMLRSFFSMKSDTDPTYGFVWGIRTLGFLDLALLTLSIILV 292

  Fly   193 QPVKWHMKEEFDDEE-----------LMCISA 213
            :....|:.|...|.|           |.|..|
Yeast   293 KERLPHVIENSKDGESRWRYILRVYILQCFDA 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8034NP_573376.2 MFS 20..>197 CDD:119392 44/188 (23%)
MFS <437..583 CDD:119392
MFS_1 437..>581 CDD:284993
MCH5NP_014951.4 MFS_MCT_SLC16 106..510 CDD:340910 53/221 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I2686
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm13433
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11360
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.