DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8034 and MCH4

DIOPT Version :9

Sequence 1:NP_573376.2 Gene:CG8034 / 32924 FlyBaseID:FBgn0031011 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_014522.1 Gene:MCH4 / 854030 SGDID:S000005479 Length:501 Species:Saccharomyces cerevisiae


Alignment Length:222 Identity:51/222 - (22%)
Similarity:98/222 - (44%) Gaps:37/222 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PDGGW-GWVACFGVSLVNLATRSIEPSFGLLFGDTLKEL----------NVGTTGAAVIISALDV 64
            ||||. .|:..||      |...:.|.|||:  ::|..:          |:.::..:.|.| |.:
Yeast    90 PDGGLKAWLVVFG------AFMGLVPVFGLI--NSLGAIESYISKHQLANISSSTISWIFS-LYL 145

  Fly    65 CMNF-SGLFVGPLLKEFSYRKVAIAGSLLCGLGLALTSPATSMAHILSTYSVINGIGVGLSTSAA 128
            .::| |.:..|..........:...|:::...||...:...|:...:..:||.:|:|.|:..:..
Yeast   146 AISFLSCILSGGYFDRNGSIGLMCTGTVIYAGGLFALANCKSVWQFILAFSVCSGLGTGILMTPL 210

  Fly   129 FVALNHYFKHKRGQAVGLSMAGTAMGMLIMPQLVRILLEAYDFRGAVLLLAGVALNATV-GSVL- 191
            ...:..:|..:||.|..:|..|.::|.::.|.::|.|.:...|:.|:.:|:.:.|...: .||| 
Yeast   211 IGTVATWFLKRRGIATSISTMGGSIGGIVFPIMLRKLYKEVGFQWAIRILSFICLTCLICASVLA 275

  Fly   192 -------LQP-------VKWHMKEEFD 204
                   :||       .||::...|:
Yeast   276 RERTKPVVQPFKSKAEVAKWYISSVFN 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8034NP_573376.2 MFS 20..>197 CDD:119392 43/203 (21%)
MFS <437..583 CDD:119392
MFS_1 437..>581 CDD:284993
MCH4NP_014522.1 MFS_MCT_SLC16 96..490 CDD:340910 47/216 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm13433
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11360
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.