DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8034 and LOC733714

DIOPT Version :9

Sequence 1:NP_573376.2 Gene:CG8034 / 32924 FlyBaseID:FBgn0031011 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001037956.1 Gene:LOC733714 / 733714 -ID:- Length:425 Species:Xenopus tropicalis


Alignment Length:161 Identity:43/161 - (26%)
Similarity:70/161 - (43%) Gaps:13/161 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DTLKELNVGTTGAAVIISALDVCMNFSGLFVGPLLKEFSYRKVAIAGSLLCGLGLALTSPATSMA 107
            |.|.|.|| ..|..:.|.||  ....:...||.::....|......|:::..|...:.:.|.|.|
 Frog    86 DYLNEENV-LVGLLLAIKAL--LQLLTNPIVGKIINRTGYDAPLFCGTIIMFLSTLMFAFADSYA 147

  Fly   108 HILSTYSVINGIGVGLSTSAAFVALNHYFKH--KRGQAVGLSMAGTAMGMLIMPQLVRILLEAYD 170
             .|.....:.|||...:...|...|.|.|..  :||:|:|::::|.|:|:|..|.....:   |:
 Frog   148 -FLCVARGLQGIGSSFTAVPALGMLAHVFPDDAERGKAMGIALSGVAIGVLAGPPFGSAM---YE 208

  Fly   171 FRGAVLLLAGVALNATVGSVL----LQPVKW 197
            |.|.......:|..|.:..||    |:|.::
 Frog   209 FVGKSAPFLAIAALALLDGVLQLCILRPTRF 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8034NP_573376.2 MFS 20..>197 CDD:119392 43/159 (27%)
MFS <437..583 CDD:119392
MFS_1 437..>581 CDD:284993
LOC733714NP_001037956.1 MFS_1 94..370 CDD:284993 38/152 (25%)
2_A_01_02 96..237 CDD:273318 37/146 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.