DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8034 and adam33

DIOPT Version :9

Sequence 1:NP_573376.2 Gene:CG8034 / 32924 FlyBaseID:FBgn0031011 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_012819411.2 Gene:adam33 / 677728 XenbaseID:XB-GENE-988107 Length:913 Species:Xenopus tropicalis


Alignment Length:154 Identity:34/154 - (22%)
Similarity:53/154 - (34%) Gaps:62/154 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   500 TIFLVSIIFVALTRSIMAEQTEWTQLMIWLSICGFFR--GSALSNFTLTVSEYCSLEKL--PSAF 560
            ||||| |:|:.|...:......|            :|  ||.|:.:.......|||.|.  |.| 
 Frog   698 TIFLV-ILFLVLLLGLAIAMVYW------------YRKPGSLLNKWLKKSKAKCSLCKATQPKA- 748

  Fly   561 GWHLVGKALFVITFGPLIGLIRDVTDSYPICIHTQSVCIMICATAWGIEYLVEYIQSRRRTADAA 625
                 .:|     :...|..:||:  |||:                              .:|:.
 Frog   749 -----NRA-----YSSKIFTMRDI--SYPV------------------------------KSDSK 771

  Fly   626 QLPTQDV--GATTTATSDQNDVKL 647
            |..::|:  |.||.|.:..:.|.:
 Frog   772 QTHSRDIFQGKTTAAQNSSHPVNV 795

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8034NP_573376.2 MFS 20..>197 CDD:119392
MFS <437..583 CDD:119392 21/86 (24%)
MFS_1 437..>581 CDD:284993 21/84 (25%)
adam33XP_012819411.2 Pep_M12B_propep 36..158 CDD:396235
Reprolysin 206..405 CDD:396140
DISIN 422..496 CDD:214490
ACR 498..639 CDD:214743
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3970
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.