DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8034 and SLC16A2

DIOPT Version :9

Sequence 1:NP_573376.2 Gene:CG8034 / 32924 FlyBaseID:FBgn0031011 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_006508.2 Gene:SLC16A2 / 6567 HGNCID:10923 Length:539 Species:Homo sapiens


Alignment Length:168 Identity:52/168 - (30%)
Similarity:83/168 - (49%) Gaps:14/168 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QPRKVAPDGGWGWVACFGVSLVNLATRSIEPSFGLLFGDTL---KELNVGTTGAAVIISALDVCM 66
            ||    |:||:|||..|..:..|.:...|..|.|:|:...|   ||.|......|..:.||.:.|
Human    93 QP----PEGGFGWVVVFAATWCNGSIFGIHNSVGILYSMLLEEEKEKNRQVEFQAAWVGALAMGM 153

  Fly    67 NFSGLFVGPLLKEFS----YRKVAIAGSLLCGLGLALTSPATSMAHILSTYSVINGIGVGLSTSA 127
            .|   |..|::..|:    .|..|.||:.:..:||..:|..:|::....||.::.|.|...:...
Human   154 IF---FCSPIVSIFTDRLGCRITATAGAAVAFIGLHTSSFTSSLSLRYFTYGILFGCGCSFAFQP 215

  Fly   128 AFVALNHYFKHKRGQAVGLSMAGTAMGMLIMPQLVRIL 165
            :.|.|.|||:.:.|.|.|:..||:::..:..|.|:|:|
Human   216 SLVILGHYFQRRLGLANGVVSAGSSIFSMSFPFLIRML 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8034NP_573376.2 MFS 20..>197 CDD:119392 44/153 (29%)
MFS <437..583 CDD:119392
MFS_1 437..>581 CDD:284993
SLC16A2NP_006508.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..92
2A0113 86..513 CDD:273325 52/168 (31%)
MFS 101..498 CDD:119392 46/156 (29%)
DUF1564 <286..>334 CDD:284922
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 508..539
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.