Sequence 1: | NP_573376.2 | Gene: | CG8034 / 32924 | FlyBaseID: | FBgn0031011 | Length: | 647 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001032485.1 | Gene: | slc16a7 / 641419 | ZFINID: | ZDB-GENE-051113-248 | Length: | 465 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 54/196 - (27%) |
---|---|---|---|
Similarity: | 95/196 - (48%) | Gaps: | 2/196 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 PDGGWGWVACFGVSLVNLA-TRSIEPSFGLLFGDTLKELNVGTTGAAVIISALDVCMNFSGLFVG 74
Fly 75 PLLKEFSYRKVAIAGSLLCGLGLALTSPATSMAHILSTYSVINGIGVGLSTSAAFVALNHYFKHK 139
Fly 140 RGQAVGLSMAGTAMGMLIMPQLVRILLEAYDFRGAVLLLAGVALNATVGSVLLQPVKWHMKEEFD 204
Fly 205 D 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8034 | NP_573376.2 | MFS | 20..>197 | CDD:119392 | 45/177 (25%) |
MFS | <437..583 | CDD:119392 | |||
MFS_1 | 437..>581 | CDD:284993 | |||
slc16a7 | NP_001032485.1 | 2A0113 | 1..440 | CDD:273325 | 54/196 (28%) |
MFS | 20..420 | CDD:119392 | 48/190 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2504 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D916876at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |