DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8034 and slc16a7

DIOPT Version :9

Sequence 1:NP_573376.2 Gene:CG8034 / 32924 FlyBaseID:FBgn0031011 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001032485.1 Gene:slc16a7 / 641419 ZFINID:ZDB-GENE-051113-248 Length:465 Species:Danio rerio


Alignment Length:196 Identity:54/196 - (27%)
Similarity:95/196 - (48%) Gaps:2/196 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PDGGWGWVACFGVSLVNLA-TRSIEPSFGLLFGDTLKELNVGTTGAAVIISALDVCMNFSGLFVG 74
            |||||||...|| |.:::. :.:...|..:.|.:..:..::..:..|.:.|.:...|...|....
Zfish    14 PDGGWGWAVVFG-SFISIGFSYAFPKSLTIYFKEIQEYFSISYSQIAWVSSIMLATMYAGGPVSS 77

  Fly    75 PLLKEFSYRKVAIAGSLLCGLGLALTSPATSMAHILSTYSVINGIGVGLSTSAAFVALNHYFKHK 139
            .|:..:..|.|.|||.|:.|:.:...|..||:.|:.....||.|.|:......|...:..||..|
Zfish    78 ILVNRYGSRPVVIAGGLMVGVAMVTASFGTSILHLYLCVGVIGGFGLAFDLQPALTIIGKYFLVK 142

  Fly   140 RGQAVGLSMAGTAMGMLIMPQLVRILLEAYDFRGAVLLLAGVALNATVGSVLLQPVKWHMKEEFD 204
            |..|.|::|||:.:.:..:..:.:.|.:.:.:||:..:|.||..|..|...|::|:|..:.:..:
Zfish   143 RPMANGIAMAGSPVFLSTLAPVNQFLFDQFGWRGSFFILGGVLFNCCVAGSLMRPIKIPVSKTTE 207

  Fly   205 D 205
            |
Zfish   208 D 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8034NP_573376.2 MFS 20..>197 CDD:119392 45/177 (25%)
MFS <437..583 CDD:119392
MFS_1 437..>581 CDD:284993
slc16a7NP_001032485.1 2A0113 1..440 CDD:273325 54/196 (28%)
MFS 20..420 CDD:119392 48/190 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.