DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8034 and zgc:114041

DIOPT Version :9

Sequence 1:NP_573376.2 Gene:CG8034 / 32924 FlyBaseID:FBgn0031011 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001025143.1 Gene:zgc:114041 / 574425 ZFINID:ZDB-GENE-050706-122 Length:433 Species:Danio rerio


Alignment Length:270 Identity:79/270 - (29%)
Similarity:119/270 - (44%) Gaps:34/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SKQPRKVAPDGGWGWVACFGVSLVNLATRSIEPSFGLLFGDTLKELNVGTTGAAVIISALDVCMN 67
            |:.|    ||||:|||.......:...|.::..:|||.|.:.....:|.|:..:::.|......:
Zfish     5 SRDP----PDGGYGWVVVASAFFIMGLTAAVLKNFGLFFLELQNYYSVLTSTTSLMTSTTIAVFH 65

  Fly    68 FSGLFVGPLLKEFSYRKVAIAGSLLCGLGLALTSPATSMAHILSTYSVINGIGVGLSTSAAFVAL 132
            ........|....|.|.|.:.|.||...|:.:.|...|:..:..:..||.|:||..:...|...:
Zfish    66 LGSPLASALSMHLSQRPVIMVGGLLAASGMIIASLGLSLPWMYLSVGVIQGLGVSFTWVPANSMV 130

  Fly   133 NHYFKHKRGQAVGLSMAGTAM-GMLIMPQLVRILLEAYDFRGAVLLLAGVALNATVGSVL---LQ 193
            |||||..|..|..:|.:|..: ||...| ..:.|:|:|.:|||:|::.|:.||..|...|   ||
Zfish   131 NHYFKRWRPIACAISSSGECVFGMAFSP-FFQWLIESYSWRGALLVIGGLQLNLIVCGALMKPLQ 194

  Fly   194 PVKWHMKEEFDDEE---------LMCISALPTPQPQLTVGGAGGAASAG---APVFKVIKEDGNE 246
            ||:...|...|.:|         ..| |.:..|:..|.:..|..|| ||   .|:|.|       
Zfish   195 PVQTSRKAVLDSKEGTGTSKKVTFQC-SLIQRPELLLYIVFAIFAA-AGFFIPPLFLV------- 250

  Fly   247 EDALPEMNTL 256
                |.:|.|
Zfish   251 ----PYVNNL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8034NP_573376.2 MFS 20..>197 CDD:119392 52/180 (29%)
MFS <437..583 CDD:119392
MFS_1 437..>581 CDD:284993
zgc:114041NP_001025143.1 2A0111 15..396 CDD:273323 72/256 (28%)
MFS 18..403 CDD:119392 70/253 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.