DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8034 and slc16a10

DIOPT Version :9

Sequence 1:NP_573376.2 Gene:CG8034 / 32924 FlyBaseID:FBgn0031011 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001073497.1 Gene:slc16a10 / 566499 ZFINID:ZDB-GENE-040724-214 Length:505 Species:Danio rerio


Alignment Length:212 Identity:56/212 - (26%)
Similarity:98/212 - (46%) Gaps:29/212 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KQPRKV-APDGGWGWVACFGVSLVNLATRSIEPSFGLLFGDTLKELNVGTTGAAVI------ISA 61
            |.|.:. .|:||||||........|.:...|:.:||::|...|.|.  |:...|.:      :.:
Zfish    57 KSPEEFEPPEGGWGWVVMLASMWCNGSVFGIQNAFGIMFVYLLNEF--GSEHDADLRFKTAWVGS 119

  Fly    62 LDVCMNFSGLFVGPLLKEFS----YRKVAIAGSLLCGLGLALTSPATSMAHILSTYSVINGIGVG 122
            |.:.|.|   |..|::..|:    .|..|:.|:.:..:||..:|..||:..:..||.::...|..
Zfish   120 LSMGMIF---FCSPIVSVFTDLLGCRITAVGGAAVGCVGLLASSFVTSLGPMYFTYGIVFACGCS 181

  Fly   123 LSTSAAFVALNHYFKHKRGQAVGLSMAGTAMGMLIMPQLVRILLEAYDFRGA---------VLLL 178
            .:...:.|.|.||||.:.|...|:..||:::..:.:|.::..||::......         :|:|
Zfish   182 FAYQPSLVILGHYFKRRLGLVNGIVTAGSSVFTITLPYMLSGLLKSVGLYHTLRVLAIFMFILML 246

  Fly   179 AGVALNATVGSVLLQPV 195
            ||:    |...:|.:||
Zfish   247 AGL----TYKPLLPKPV 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8034NP_573376.2 MFS 20..>197 CDD:119392 47/195 (24%)
MFS <437..583 CDD:119392
MFS_1 437..>581 CDD:284993
slc16a10NP_001073497.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..64 2/6 (33%)
2A0113 56..458 CDD:273325 56/212 (26%)
MFS 71..462 CDD:119392 49/198 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 474..505
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.