DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8034 and CG8389

DIOPT Version :9

Sequence 1:NP_573376.2 Gene:CG8034 / 32924 FlyBaseID:FBgn0031011 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_611076.2 Gene:CG8389 / 36764 FlyBaseID:FBgn0034063 Length:471 Species:Drosophila melanogaster


Alignment Length:637 Identity:169/637 - (26%)
Similarity:267/637 - (41%) Gaps:176/637 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QPRKVAPDGGWGWVACFGVSLVNLATRSIEPSFGLLFGDTLKELNVGTTGAAVIISALDVCMNFS 69
            |..:|.||||:||:....|:|:|:..:||...||.||...|:::...|..||:|.:...:.:|||
  Fly     4 QSSRVVPDGGYGWIVVAAVALINMTNQSILSVFGQLFVGELQKMQEDTFTAALITNLNSLALNFS 68

  Fly    70 GLFVGPLLKEFSYRKVAIAGSLLCGLGLALTSPATSMAHILSTYSVINGIGVGLSTSAAFVALNH 134
            |||:||.:|.|..|.||..|.:|..|||||.:.|:...|.:..||...|.|:||.:.:.|:|:|.
  Fly    69 GLFIGPAIKSFKPRNVAATGCILVALGLALCAFASESWHFILGYSFFVGFGLGLISPSTFMAINS 133

  Fly   135 YFKHKRGQAVGLSMAGTAMGMLIMPQLVRILLEAYDFRGAVLLLAGVALNATVGSVLLQPVKWHM 199
            ||..|||:|||:|:||..:|.:::|.|||.||:.:.||.|||.::.::|....|:..|:|:.   
  Fly   134 YFTTKRGRAVGVSLAGAGLGQVLIPHLVRYLLDNHGFRYAVLSMSSLSLFGLFGAAFLKPLN--- 195

  Fly   200 KEEFDDEELMCISALPTPQPQLTVGGAGGAASAGAPVFKVIKEDGNEEDALPEMNTLLFHKPHPH 264
                                                                          .|.
  Fly   196 --------------------------------------------------------------PPA 198

  Fly   265 QHSMRKNYSEMAMNTMNGSRLGIPKRPTFPRIMSLAGVQSAAHGAGGDSGGYTSQAEVNATQLRC 329
            :|:.||:.                      |:::.|            .|..||..:|       
  Fly   199 KHNNRKHI----------------------RLLTEA------------DGEKTSPLQV------- 222

  Fly   330 RKASVTSNLSYMDFTGSILQVHLNTGDDEFEQNDRELRRVGTATGSIVLGGHRDSFIKMKPTELD 394
                                                           |:.....|.|:..|..:|
  Fly   223 -----------------------------------------------VIVPTNQSKIERSPPNVD 240

  Fly   395 KQAEAAAALDEEAKKKAKKPGFWRRFADLLDIDMLKDKMFLNLLFGLSIFYVAEMNFKMVTPFFF 459
            .......                :|....:|:::|||.:|.:::.|:::.|.|.:||.|:.|.|.
  Fly   241 TLCSRMG----------------QRLVQAMDLELLKDLVFWSIIVGMALVYTATINFTMIFPGFL 289

  Fly   460 ---ANLGYQKTDVAFCLSITAITDIAARIVLPPIFDRTTIKKRTIFLVSIIFVALTRSIMAEQTE 521
               |.|..|.  ||||:|:.|..||..|::||.:.|...|..|.:||:.|:.:.:.|.::||...
  Fly   290 GQTAQLNSQM--VAFCMSLVAGADIVFRLLLPIVTDHLRIPYRVVFLIGIVGLFVARCVLAENQT 352

  Fly   522 WTQLMIWLSICGFFRGSALSNFTLTVSEYCSLEKLPSAFGWHLVGKALFVITFGPLIGLIRDVTD 586
            ...::....:.|..:.:.:.|..||:|.:|..|||....|..::.|.:.|||.|.|:|.:||..|
  Fly   353 LPVIITMSVLTGMMKSATVINNNLTISAHCRSEKLAGGLGLSMMSKGVIVITVGQLLGWVRDYAD 417

  Fly   587 SYPICIHTQSVCIMICATAWGIEYLVEYIQSRRRTADAAQLPTQDVGATTTA 638
            ||.||::.|.|.:::....|..|.|  |...|:|.|....:.||.:.|...|
  Fly   418 SYLICLYAQGVILLVVVLVWTPEIL--YRHRRQRCATNKSMETQSIDAAEVA 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8034NP_573376.2 MFS 20..>197 CDD:119392 72/176 (41%)
MFS <437..583 CDD:119392 48/148 (32%)
MFS_1 437..>581 CDD:284993 48/146 (33%)
CG8389NP_611076.2 MFS 19..425 CDD:119392 148/576 (26%)
MFS_1 19..400 CDD:284993 135/551 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I2686
eggNOG 1 0.900 - - E1_KOG2504
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D334255at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11360
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.