DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8034 and Slc16a11

DIOPT Version :9

Sequence 1:NP_573376.2 Gene:CG8034 / 32924 FlyBaseID:FBgn0031011 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_694721.2 Gene:Slc16a11 / 216867 MGIID:2663709 Length:447 Species:Mus musculus


Alignment Length:229 Identity:66/229 - (28%)
Similarity:103/229 - (44%) Gaps:22/229 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PDGGWGWVACFGVSLVNLATRSIEPSFGLLFGDTLKELNVGTTGAAVIISALDVCMNFSGLFVGP 75
            ||||||||.......||..:..:..|.||...|..:.........| .:|||.:.:..:...||.
Mouse     9 PDGGWGWVVAAAAFAVNGLSYGLLRSLGLALPDLAEHFERSAQDTA-WVSALALAVQQAASPVGS 72

  Fly    76 LLK-EFSYRKVAIAGSLLCGLGLALTSPATSMAHILSTYSVINGIGVGLSTSAAFVALNHYFKHK 139
            .|. .:..|.|.:.|.:|..|||..::.|.|:.|:.....::.|.|..|..:.|...|:.||..:
Mouse    73 ALSTRWGARPVVMVGGVLTSLGLVFSAFARSLLHLYLGLGLLAGSGWALVFAPALGTLSRYFSRR 137

  Fly   140 RGQAVGLSMAGTAMGMLIMPQLVRILLEAYDFRGAVLLLAGVALNATVGSVLLQPVKWHMKEEFD 204
            |..||||::.|.....|::...::.||:.:.:|||:|||..|.|:.|....||:|          
Mouse   138 RVLAVGLALTGNGASSLLLAPALQFLLDTFGWRGALLLLGAVTLHLTPCGALLRP---------- 192

  Fly   205 DEELMCISALPTPQPQLTVGGAGGAASAGAPVFK 238
                :.:|..|...|:..:      |:.|..:||
Mouse   193 ----LALSGDPLAPPRTPL------AALGLGLFK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8034NP_573376.2 MFS 20..>197 CDD:119392 51/177 (29%)
MFS <437..583 CDD:119392
MFS_1 437..>581 CDD:284993
Slc16a11NP_694721.2 MFS 14..403 CDD:391944 61/224 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.