DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8034 and Slc16a11

DIOPT Version :10

Sequence 1:NP_573376.2 Gene:CG8034 / 32924 FlyBaseID:FBgn0031011 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_694721.2 Gene:Slc16a11 / 216867 MGIID:2663709 Length:447 Species:Mus musculus


Alignment Length:229 Identity:66/229 - (28%)
Similarity:103/229 - (44%) Gaps:22/229 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PDGGWGWVACFGVSLVNLATRSIEPSFGLLFGDTLKELNVGTTGAAVIISALDVCMNFSGLFVGP 75
            ||||||||.......||..:..:..|.||...|..:.........| .:|||.:.:..:...||.
Mouse     9 PDGGWGWVVAAAAFAVNGLSYGLLRSLGLALPDLAEHFERSAQDTA-WVSALALAVQQAASPVGS 72

  Fly    76 LLK-EFSYRKVAIAGSLLCGLGLALTSPATSMAHILSTYSVINGIGVGLSTSAAFVALNHYFKHK 139
            .|. .:..|.|.:.|.:|..|||..::.|.|:.|:.....::.|.|..|..:.|...|:.||..:
Mouse    73 ALSTRWGARPVVMVGGVLTSLGLVFSAFARSLLHLYLGLGLLAGSGWALVFAPALGTLSRYFSRR 137

  Fly   140 RGQAVGLSMAGTAMGMLIMPQLVRILLEAYDFRGAVLLLAGVALNATVGSVLLQPVKWHMKEEFD 204
            |..||||::.|.....|::...::.||:.:.:|||:|||..|.|:.|....||:|          
Mouse   138 RVLAVGLALTGNGASSLLLAPALQFLLDTFGWRGALLLLGAVTLHLTPCGALLRP---------- 192

  Fly   205 DEELMCISALPTPQPQLTVGGAGGAASAGAPVFK 238
                :.:|..|...|:..:      |:.|..:||
Mouse   193 ----LALSGDPLAPPRTPL------AALGLGLFK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8034NP_573376.2 MFS 16..>193 CDD:475125 52/177 (29%)
MFS <428..609 CDD:475125
Slc16a11NP_694721.2 MFS 14..403 CDD:475125 61/224 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.