DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8034 and F10G7.5

DIOPT Version :9

Sequence 1:NP_573376.2 Gene:CG8034 / 32924 FlyBaseID:FBgn0031011 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001359987.1 Gene:F10G7.5 / 173806 WormBaseID:WBGene00017369 Length:471 Species:Caenorhabditis elegans


Alignment Length:184 Identity:44/184 - (23%)
Similarity:74/184 - (40%) Gaps:32/184 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KVAPDGGWGWVACFGVSLVNLATRSIEPSFGLLF--GDTLKELNVG----------TTGAAV--- 57
            |..|.|...|....| .::.:.|      ||:::  |:.|..| |.          .||..:   
 Worm    23 KRLPRGARPWAVLVG-GVMCMVT------FGIVYTCGNLLPYL-VSYFRWKMYPDMRTGQLIWLQ 79

  Fly    58 -IISALDVCMNFSGLFVGPLL-KEFSYRKVAIAGSLL--CGLGLALTSPATSMAHILSTYSVING 118
             ::|.|.:     |:.:|.|: ::|..|..|:.||::  .|:|....|...|.|..|.|...|..
 Worm    80 TLLSGLPM-----GMVIGGLVERKFGGRAGALLGSIIYTIGVGSTFYSIQHSYAATLLTMGGIAS 139

  Fly   119 IGVGLSTSAAFVALNHYFKHKRGQAVGLSMAGTAMGMLIMPQLVRILLEAYDFR 172
            :|..::.|:.......:|....|.|.|:.:.|...|..|:..|....:...|:|
 Worm   140 VGSSIAYSSILPTAQRWFPDNVGLAGGIIIGGYGCGAFILSPLQTTFINPLDYR 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8034NP_573376.2 MFS 20..>197 CDD:119392 40/172 (23%)
MFS <437..583 CDD:119392
MFS_1 437..>581 CDD:284993
F10G7.5NP_001359987.1 2A0111 30..439 CDD:273323 41/177 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.