DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8034 and SLC16A10

DIOPT Version :9

Sequence 1:NP_573376.2 Gene:CG8034 / 32924 FlyBaseID:FBgn0031011 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_061063.2 Gene:SLC16A10 / 117247 HGNCID:17027 Length:515 Species:Homo sapiens


Alignment Length:290 Identity:67/290 - (23%)
Similarity:107/290 - (36%) Gaps:88/290 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASKQPRK--VAPDGGWGWVACFGVSLVNLATRSIEPSFGLLFGDTLKELN-------------VG 51
            |:.:|.:  ..|:|||||:........|.:...|:.:.|:||...|:...             ||
Human    54 ATAEPHEPPEPPEGGWGWLVMLAAMWCNGSVFGIQNACGVLFVSMLETFGSKDDDKMVFKTAWVG 118

  Fly    52 TTGAAVIISALDVCMNFSGLFVGPLLKEFSYRKVAIAGSLLCGLGLALTSPATSMAHILSTYSVI 116
            :....:|.....:...|:.|        |..||.|:.|:.:..:||..:|..:|:..:..||.:|
Human   119 SLSMGMIFFCCPIVSVFTDL--------FGCRKTAVVGAAVGFVGLMSSSFVSSIEPLYLTYGII 175

  Fly   117 NGIGVGLSTSAAFVALNHYFKHKRGQAVGLSMAGTAMGMLIMPQLVRILLEA----YDFRGA--- 174
            ...|...:...:.|.|.||||.:.|...|:..||:::..:::|.|:|:|:::    |..|..   
Human   176 FACGCSFAYQPSLVILGHYFKKRLGLVNGIVTAGSSVFTILLPLLLRVLIDSVGLFYTLRVLCIF 240

  Fly   175 --VLLLAGVALNATV-----------GSVLLQPVK--------------------W--------- 197
              ||.|||.......           ||.|....|                    |         
Human   241 MFVLFLAGFTYRPLATSTKDKESGGSGSSLFSRKKFSPPKKIFNFAIFKVTAYAVWAVGIPLALF 305

  Fly   198 -----------HMKEEFDDEE-----LMCI 211
                       |:.|.|.||:     ||||
Human   306 GYFVPYVHLMKHVNERFQDEKNKEVVLMCI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8034NP_573376.2 MFS 20..>197 CDD:119392 49/229 (21%)
MFS <437..583 CDD:119392
MFS_1 437..>581 CDD:284993
SLC16A10NP_061063.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48
2A0113 67..487 CDD:273325 64/277 (23%)
MFS 71..470 CDD:119392 60/273 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.