Sequence 1: | NP_573376.2 | Gene: | CG8034 / 32924 | FlyBaseID: | FBgn0031011 | Length: | 647 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_061063.2 | Gene: | SLC16A10 / 117247 | HGNCID: | 17027 | Length: | 515 | Species: | Homo sapiens |
Alignment Length: | 290 | Identity: | 67/290 - (23%) |
---|---|---|---|
Similarity: | 107/290 - (36%) | Gaps: | 88/290 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 ASKQPRK--VAPDGGWGWVACFGVSLVNLATRSIEPSFGLLFGDTLKELN-------------VG 51
Fly 52 TTGAAVIISALDVCMNFSGLFVGPLLKEFSYRKVAIAGSLLCGLGLALTSPATSMAHILSTYSVI 116
Fly 117 NGIGVGLSTSAAFVALNHYFKHKRGQAVGLSMAGTAMGMLIMPQLVRILLEA----YDFRGA--- 174
Fly 175 --VLLLAGVALNATV-----------GSVLLQPVK--------------------W--------- 197
Fly 198 -----------HMKEEFDDEE-----LMCI 211 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8034 | NP_573376.2 | MFS | 20..>197 | CDD:119392 | 49/229 (21%) |
MFS | <437..583 | CDD:119392 | |||
MFS_1 | 437..>581 | CDD:284993 | |||
SLC16A10 | NP_061063.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..48 | ||
2A0113 | 67..487 | CDD:273325 | 64/277 (23%) | ||
MFS | 71..470 | CDD:119392 | 60/273 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2504 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D916876at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |