DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8034 and slc16a7

DIOPT Version :9

Sequence 1:NP_573376.2 Gene:CG8034 / 32924 FlyBaseID:FBgn0031011 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001106392.1 Gene:slc16a7 / 100127205 XenbaseID:XB-GENE-1008526 Length:475 Species:Xenopus tropicalis


Alignment Length:614 Identity:117/614 - (19%)
Similarity:195/614 - (31%) Gaps:231/614 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PDGGWGWVACFGVSLVNLATRSIEPSFGLLFGDTLKELNVGTTGAAVIISALDVCMNFSGLFVGP 75
            ||||||||..|| |.:::......|....:|...::|:...:......||::.:.:.::|   ||
 Frog    13 PDGGWGWVVVFG-SFISIGFSYAFPKAITVFFKEIQEIFNTSYSEIAWISSIMLAVMYAG---GP 73

  Fly    76 ----LLKEFSYRKVAIAGSLLCGLGLALTSPATSMAHILSTYSVINGIGVGLSTSAAFVALNHYF 136
                |:.::..|.|.|.|.:||.|.:...|...|:..:.....|:.|.|:..:...:...:..||
 Frog    74 ISSILVNKYGSRPVVIGGGVLCSLAMISASFCNSVMQLYICIGVMGGFGLAFNLQPSLTIIGKYF 138

  Fly   137 KHKRGQAVGLSMAGTAMGMLIMPQLVRILLEAYDFRGAVLLLAGVALNATVGSVLLQPVKWHMKE 201
            ..||..|.||:|||:.:.:..:..|.:.|...:.:||:.|:|.|:.||..|...|::|:      
 Frog   139 FKKRPIANGLAMAGSPVFLSTLAPLNQFLFNQFGWRGSFLILGGLLLNCCVAGSLMRPI------ 197

  Fly   202 EFDDEELMCISALPTPQPQLTVGGAGGAASAGAPVFKVIKEDGNEEDALPEMNTLLFHKPHPHQH 266
                          .|:|                    :|:|                       
 Frog   198 --------------GPKP--------------------VKKD----------------------- 205

  Fly   267 SMRKNYSEMAMNTMNGSRLGIPKRPTFPRIMSLAGVQSAAHGAGGDSGGYTSQAEVNATQLRCRK 331
                                |.|.|.                                       
 Frog   206 --------------------IEKAPK--------------------------------------- 211

  Fly   332 ASVTSNLSYMDFTGSILQVHLNTGDDEFEQNDRELRRVGTATGSIVLGGHRDSFIKMKPTELDKQ 396
                                    |||                     .|:              
 Frog   212 ------------------------DDE---------------------NHK-------------- 217

  Fly   397 AEAAAALDEEAKKKAKKPGFWRRFADLLDIDMLKDKMFLNLLFGLSIFYVAEMNFKMVTPFFFA- 460
                           ||....:.....||:.:.|.:.||..|.|..|.::.          ||| 
 Frog   218 ---------------KKESVCQSINKYLDLSLFKHRGFLIYLSGNVIMFIG----------FFAP 257

  Fly   461 ---------NLGYQKTDVAFCLSITAITDIAARIVLPPIFDRTTIKKRT--IFLVSIIFVALTRS 514
                     ::|..:...||.|||.|..|:.||..:..:.:...|:.|.  .|..:|::..:...
 Frog   258 IVFLAPYAKHMGIDQYSSAFLLSILAFVDMVARPTMGMVANTRFIRPRIQYFFSFAILYNGVCHL 322

  Fly   515 IMAEQTEWTQLMIWLSICGFFRGSALSNFTLTVSEYCSLEKLPSAFGWHLVGKALFVITFGPLIG 579
            :.....::|.|:|:....||..|...|....|:.:.....:..||.|...:.:...|:...||.|
 Frog   323 LCPLANDYTGLVIYAVFFGFAFGMVSSVLFETLMDIVGAARFSSAVGLTTIVECCPVLIGPPLGG 387

  Fly   580 LIRDVTDSYPICIHTQSVC--IMICATAW 606
            .:.|||.:|.   :...||  |:|.|:.|
 Frog   388 FLVDVTGNYK---YMYFVCGVIVIIASIW 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8034NP_573376.2 MFS 20..>197 CDD:119392 46/180 (26%)
MFS <437..583 CDD:119392 35/157 (22%)
MFS_1 437..>581 CDD:284993 35/155 (23%)
slc16a7NP_001106392.1 2A0113 10..447 CDD:273325 117/614 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.