DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8028 and slc16a12

DIOPT Version :9

Sequence 1:NP_001097031.2 Gene:CG8028 / 32923 FlyBaseID:FBgn0031010 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_989310.1 Gene:slc16a12 / 394932 XenbaseID:XB-GENE-1012784 Length:473 Species:Xenopus tropicalis


Alignment Length:516 Identity:120/516 - (23%)
Similarity:186/516 - (36%) Gaps:92/516 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PDGGWGILVCIGMALPFTSALAALPSFGLVFGEFLKSIGAETSAMAIITSAF-FSSMSFAGLFSG 97
            ||||||.::.||.........|......:.|.||......:.:..|.|.|.. .|:|..|.:  |
 Frog    13 PDGGWGWMIVIGCFFVTVCTRAVTRCISIFFVEFQSYFAQDYARTAWIHSIVDCSTMLCAPI--G 75

  Fly    98 SLFQRFGMRQVG-VTGGILYFLGTGMQLFATSTLHLIMAFSVVQGFAFGLMVPTCYTTFNHYFVK 161
            |........||| :.||:|...|..:..||||..:|.:...|:.|..|.|...........||.|
 Frog    76 SYVSNHFSCQVGIILGGVLASTGLVLSSFATSLEYLYLTLGVLTGLGFALCYSPAIAMVGKYFEK 140

  Fly   162 NRVMWMSFAQTLIGLGSMLYPIVMQKLMSWYGFRGCLLILTGLNAHAVFGMLVMHPVEWHMRRVP 226
            .:.:....|.:..|:|:.:...|:|.|:..:.:||.||||.|..::......:|.|:        
 Frog   141 RKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVSNLCVCGALMRPI-------- 197

  Fly   227 IQPEEQEELKELSPTVVIRVQPETPLKATREEPNFHTADPGARKLSHAEEQMLK--VLSSRASSI 289
                   .|||.|        ...|||                     :|||..  ..|.|..|.
 Frog   198 -------TLKEDS--------LHYPLK---------------------QEQMENEPTQSGRLDSS 226

  Fly   290 TSLGNWSGPVVVSDASPQMMHSLQTSRRPSTIAGASGAVAPAHATKKSWVRTIVDFLDLTLLKKP 354
            .|       .:..|.|.:.:                     .:.|||.:          :.|.||
 Frog   227 CS-------PLCQDCSHKRL---------------------CYCTKKEY----------SFLLKP 253

  Fly   355 IFVNIVLGITFALYSDITFFTMQPVYLFELGYSRPDTATIIAIGAAADLASRI-FLAITAVCIQV 418
            .|:.:.:...|..|.....|.....|...:|.|..:.|.:::|....|:...| |..:|......
 Frog   254 KFMVLAVSFLFLAYGCSPPFVYLVPYALNVGVSNQEAAFLMSILGIIDIVGNITFGWVTDTRFLK 318

  Fly   419 PSRY-IYLAGAVFTVFARFAFNGITQFVGMACITAVIGFLRTWLHVPLPLVFADYLPKERFATGY 482
            ..|| .||...............:|:|..:...:.:.|:........:|:|..|.:.....::..
 Frog   319 KHRYCCYLIAVGLDGLCCLFLPILTRFQLLVPFSVMFGYFDGAYVALIPVVTGDVVGTSSLSSAL 383

  Fly   483 GLFMFIQGNAMFLIGPIVGFIRDKTRDYIFVFHILNGF-MILCAAPWVLEVLIVKFRRRNK 542
            |:..|:......:..||.|::.|.|.||...| :|:|| ||.||....|..:|.:.::|.|
 Frog   384 GVVFFLHAVPYLVSPPIAGWLVDTTGDYTAAF-LLSGFSMIFCAVLLALAKIINRIKKRPK 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8028NP_001097031.2 MFS 40..>215 CDD:119392 46/176 (26%)
slc16a12NP_989310.1 2A0111 12..444 CDD:331689 120/516 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11360
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X70
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.