DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8028 and slcf-1

DIOPT Version :9

Sequence 1:NP_001097031.2 Gene:CG8028 / 32923 FlyBaseID:FBgn0031010 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_509762.2 Gene:slcf-1 / 186633 WormBaseID:WBGene00010340 Length:450 Species:Caenorhabditis elegans


Alignment Length:170 Identity:40/170 - (23%)
Similarity:62/170 - (36%) Gaps:34/170 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 AETSAMAIITSAFFSSMSFAGLFSGSLFQRFGMRQVGVTGGILYFLGTGMQLFA---TSTLHLIM 134
            |:|:.:.:.    .:|....|.|....:||.|.|...:.|..|    ||.....   ...::|:|
 Worm    75 ADTAVLVVP----MASSLILGPFCSIFYQRSGARISIIAGSFL----TGGSFVVGPFCKNIYLLM 131

  Fly   135 AFSVVQGFAFGLMVPTCYTTFNHYFVKNRVMWMSFAQTLIGLGSMLYP----IVMQKLMSW---Y 192
            ..:...|...|||..:..:....||.|.|...|:......|||..:.|    .:|.|..||   :
 Worm   132 LATFGMGIGCGLMRNSIISIQCEYFKKKRNTVMAAISIGPGLGIFILPRTLKFIMVKYNSWGPAW 196

  Fly   193 GFRGCLLILTGLNAHAVFGMLVMHPVEWHMRRVPIQPEEQ 232
            .|.....|::     |:.|:.:..|           |.||
 Worm   197 WFLSLFYIVS-----AIMGLFITKP-----------PSEQ 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8028NP_001097031.2 MFS 40..>215 CDD:119392 36/151 (24%)
slcf-1NP_509762.2 MFS 44..410 CDD:119392 40/170 (24%)
MFS_1 79..376 CDD:284993 38/166 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.