DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vav and PREX1

DIOPT Version :9

Sequence 1:NP_001097030.1 Gene:Vav / 32920 FlyBaseID:FBgn0040068 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_065871.3 Gene:PREX1 / 57580 HGNCID:32594 Length:1659 Species:Homo sapiens


Alignment Length:633 Identity:152/633 - (24%)
Similarity:235/633 - (37%) Gaps:187/633 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   406 CALHRTSRSQTASSTSFEQRDYVIRELIDTESNYLDVLTALKTKFM--------GPLERHLNQDE 462
            ||..|.|..|      ...|..|:.|::.||.:|:..|..|::.|:        ..:|:.|.::.
Human    37 CAAARESERQ------LRLRLCVLNEILGTERDYVGTLRFLQSAFLHRIRQNVADSVEKGLTEEN 95

  Fly   463 LRLIFPRIRELVDIHTKFLDKLRESL--TPNAKVKMAQVFLDFREPFLIYGEFCSLLLGAIDYLA 525
            ::::|..|.:::::|..||..|...|  .|.::.::..|||.|::.|.:|.|:||....|:..|.
Human    96 VKVLFSNIEDILEVHKDFLAALEYCLHPEPQSQHELGNVFLKFKDKFCVYEEYCSNHEKALRLLV 160

  Fly   526 DVCKKNQIIDQLVQKCERDYNVGKLQLRDI-----LSVPMQRILKYHLLLDKLVKETSPLHDDYR 585
            :: .|...:...:..|   ..:|..:..||     |..|:|||.||.|||.:|.|.|...|.|:.
Human   161 EL-NKIPTVRAFLLSC---MLLGGRKTTDIPLEGYLLSPIQRICKYPLLLKELAKRTPGKHPDHP 221

  Fly   586 SLERAKEAMIDVSQYINEVKRDSDHLVIIQKVKDSICDIHLLQNGNGSDLLQY-GRLLLDGE-LH 648
            :::.|.:||..|...|||.||..:.|..:::::..|      :...||:|... .:|||.|. |.
Human   222 AVQSALQAMKTVCSNINETKRQMEKLEALEQLQSHI------EGWEGSNLTDICTQLLLQGTLLK 280

  Fly   649 IKAHEDQKTKLRYAFVFDKILIMVKALHIKTGDMQ------------YTYRDSHN---------- 691
            |.|...|:   |..|:||.:|:..|.....||..:            |.:|...|          
Human   281 ISAGNIQE---RAFFLFDNLLVYCKRKSRVTGSKKSTKRTKSINGSLYIFRGRINTEVMEVENVE 342

  Fly   692 --LADYRVEQSHSRRTIGRDTRFKYQLLLARKSGKTA----FTLYLKSEHERDKWRKAL---TEA 747
              .|||     ||.         .|.:....|...||    |....|:..|:.||..|:   .|.
Human   343 DGTADY-----HSN---------GYTVTNGWKIHNTAKNKWFVCMAKTAEEKQKWLDAIIREREQ 393

  Fly   748 MESLEPPGCQSTDHKMEIYTFDAPTTCRHCSKFLKGR--IHQGYRCKVCQISVHKGCISSTGRCK 810
            .|||:      ...:.:.|...|.          ||.  .|.....||..|...:..:|:..:| 
Human   394 RESLK------LGMERDAYVMIAE----------KGEKLYHMMMNKKVNLIKDRRRKLSTVPKC- 441

  Fly   811 QNPVSVPPPVCDRQLSEFNWFAGNMDRETAAHRLENRRIGTYLLRVRPQGPSTAHETMYALSLKT 875
                                |.||   |..|..||...|.                       ||
Human   442 --------------------FLGN---EFVAWLLEIGEIS-----------------------KT 460

  Fly   876 DDNVIKHMKINQENSGDSMLYCLSSRRHFKTIVELVSYYERNDLGENFA----------GLN--- 927
            ::.|    .:.|....:.:::.:|.:..||.  |.|.|..|.|.|...|          |:.   
Human   461 EEGV----NLGQALLENGIIHHVSDKHQFKN--EQVMYRFRYDDGTYKARSELEDIMSKGVRLYC 519

  Fly   928 --QSLQWP-----------YKEVI-ATALYDYEPKAGSNQLQLRTDCQ 961
              .||..|           ||.|: .:.|.|:        |..:.|||
Human   520 RLHSLYTPVIKDRDYHLKTYKSVLPGSKLVDW--------LLAQGDCQ 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VavNP_001097030.1 CH 20..132 CDD:278723
RhoGEF 428..603 CDD:279015 54/189 (29%)
PH_Vav 624..753 CDD:269930 41/161 (25%)
PH 641..749 CDD:278594 35/139 (25%)
C1_1 761..804 CDD:278556 8/44 (18%)
SH2_Vav_family 824..934 CDD:198193 26/135 (19%)
SH3 940..993 CDD:302595 6/22 (27%)
PREX1NP_065871.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 2/2 (100%)
RhoGEF 50..238 CDD:238091 54/191 (28%)
PH_Collybistin_ASEF 244..396 CDD:269931 40/174 (23%)
DEP 414..494 CDD:321936 24/132 (18%)
DEP_2_P-Rex 506..598 CDD:239887 13/62 (21%)
PDZ_signaling 627..703 CDD:238492
PDZ 721..773 CDD:238080
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 796..819
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.