DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vav and tagln3a

DIOPT Version :9

Sequence 1:NP_001097030.1 Gene:Vav / 32920 FlyBaseID:FBgn0040068 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_001096584.1 Gene:tagln3a / 563096 ZFINID:ZDB-GENE-060531-53 Length:213 Species:Danio rerio


Alignment Length:157 Identity:36/157 - (22%)
Similarity:62/157 - (39%) Gaps:15/157 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LRDGVLLCNLVIHLDPSSLDPREFNRKPQMAQFLCSKNIKLFLDVCHNNFGIRDADLFEPTMLY- 117
            |..|.:||.|:..|.||..:|.:...:.:|. |...:.|..||... ..:|:...|:|:...|: 
Zfish    56 LMSGTILCRLINSLYPSGEEPIKKITESKMV-FKQMEKISQFLQFA-EEYGVNRGDIFQTVDLWE 118

  Fly   118 --DLTNFHRVLITLSKLSQCRKVQQLHPDLIGFNLQLSPTERSHSDEAIYKDLHSTDLNMRKTSS 180
              |:....|.|:.|...:..:.......|...|:.:....:|..|:|.:.:.  ...:.|:..|:
Zfish   119 GKDMAAVQRTLMALGSEALTKDDGHYRGDPDWFHRKTKGHKREFSEEQLRQG--RVVIGMQMGSN 181

  Fly   181 IDASASSSAEY--------YDRTSQSG 199
            ..||.|....|        ||....:|
Zfish   182 RGASQSGMVGYGTPRQIMRYDSPRHNG 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VavNP_001097030.1 CH 20..132 CDD:278723 22/80 (28%)
RhoGEF 428..603 CDD:279015
PH_Vav 624..753 CDD:269930
PH 641..749 CDD:278594
C1_1 761..804 CDD:278556
SH2_Vav_family 824..934 CDD:198193
SH3 940..993 CDD:302595
tagln3aNP_001096584.1 SCP1 14..188 CDD:227526 31/135 (23%)
CH 25..132 CDD:278723 21/77 (27%)
Calponin 174..197 CDD:278814 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.