DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vav and arhgef9a

DIOPT Version :9

Sequence 1:NP_001097030.1 Gene:Vav / 32920 FlyBaseID:FBgn0040068 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_005165263.1 Gene:arhgef9a / 559868 ZFINID:ZDB-GENE-070705-271 Length:549 Species:Danio rerio


Alignment Length:608 Identity:137/608 - (22%)
Similarity:228/608 - (37%) Gaps:160/608 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 HV----RELSFDLALDVV----SSTTDGASNAVTPT----PESYARQSQSPLAAAAPSVPVSAAP 305
            ||    |||:|. |.||:    :|..|.....:...    |.|:.|....|              
Zfish    19 HVTMADRELAFK-AGDVIKVLDASNKDWWWGQIDEEEGWFPASFVRVESHP-------------- 68

  Fly   306 GPPMGRLVSTSSSSSSLLVSESQRLQRAAAAVYNYRSSMASTEHEYAYIYSEDDEKVYEDLCYVT 370
             |...:|...:..::|       ||..|.|.::      .:.|...|...:|...:|...     
Zfish    69 -PQSKQLFYINPVAAS-------RLTNATAKLW------VNQEENTAVEVAESSSEVQNG----- 114

  Fly   371 FQAKAKPEVTTDNIACNGTGYDHTNTKEEEVYQDLCALHRTSRSQTASSTSFEQRDYVIRELIDT 435
             .|:|.|..:||   |                  ||....|....       :.|..||.|::.|
Zfish   115 -HAEASPNPSTD---C------------------LCLGQPTQNRD-------QMRANVINEIMST 150

  Fly   436 ESNYLDVLTALKTKFMGPLERH---LNQDELRLIFPRIRELVDIHTKF---LDKLRESLTPNAKV 494
            |.:|:..|..:...::...::.   .|.|:|::||..|.::......|   |:|...:..|:.. 
Zfish   151 ERHYIKHLKDICEGYLRQCKKRRDMFNDDQLKVIFGNIEDIYRFQLSFVRDLEKQFNTEEPHLS- 214

  Fly   495 KMAQVFLDFREPFLIYGEFCSLLLGA------------IDYLADVCKKNQIIDQLVQKCERDYNV 547
            ::...||:.::.|.||.|:|:..:.|            ..:..:.|:   ::.|::.        
Zfish   215 EIGPCFLEHQDGFWIYSEYCNNHVDACMELTRLMRDARYQHFFEACR---LVQQMID-------- 268

  Fly   548 GKLQLRDILSVPMQRILKYHLLLDKLVKETSPLHDDYRSLERAKEAMIDVSQYINEVKRDSDHLV 612
              :.:...|..|:|:|.||.|.|.:|:|.|...|.|||.:..|...|.:|:|.|||.||..:::.
Zfish   269 --IAIDGYLLTPVQKICKYPLQLAELLKYTVQEHSDYRYVAAALAVMRNVTQQINERKRRLENID 331

  Fly   613 IIQKVKDSICDIHLLQNGNGSDLL-QYGRLLLDGELHIKAHEDQKTKLRYAFVFDKILIMVKALH 676
            .|.:.:.|:.|      ..|.|:| :...|:..||:........:::.|..|:||..:::.|...
Zfish   332 KIAQWQASVLD------WEGEDILDRSSELVYTGEMSWIYQPYGRSQTRIFFLFDHQMVLCKKDL 390

  Fly   677 IKTGDMQYTYRDSHNLADYRVEQSHSRRTIGRDTRF----KYQLLLARKSGKTAFTLYLKSEHER 737
            |:. |:.| |:...:|..|.|..:..    |||..|    |....||.:..........|...|:
Zfish   391 IRR-DILY-YKGRIDLDRYEVIDAID----GRDDDFNVSVKNAFKLANRDTDEIHLFLPKKLEEK 449

  Fly   738 DKWRKALTEAMESLEPPGCQSTDHKM--EIYTF---DAPTTCRHCSKFLKGRIHQGYRCKVCQIS 797
            .:|.:|..|..:.::      .|.|:  ||..:   .|..|.|..:|                  
Zfish   450 IRWLRAFQEERKMVQ------EDEKIGFEISQYQKRQAALTVRRATK------------------ 490

  Fly   798 VHKGCISSTGRCKQNPVSVPPPV 820
             .||    .||  ..|.:.||||
Zfish   491 -QKG----VGR--SVPPAYPPPV 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VavNP_001097030.1 CH 20..132 CDD:278723
RhoGEF 428..603 CDD:279015 47/192 (24%)
PH_Vav 624..753 CDD:269930 30/133 (23%)
PH 641..749 CDD:278594 27/111 (24%)
C1_1 761..804 CDD:278556 9/47 (19%)
SH2_Vav_family 824..934 CDD:198193
SH3 940..993 CDD:302595
arhgef9aXP_005165263.1 SH3_ARHGEF9_like 13..64 CDD:212762 13/45 (29%)
RhoGEF 143..322 CDD:279015 47/192 (24%)
PH_Collybistin_ASEF 327..466 CDD:269931 33/156 (21%)
PH 372..458 CDD:278594 23/91 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.