Sequence 1: | NP_001097030.1 | Gene: | Vav / 32920 | FlyBaseID: | FBgn0040068 | Length: | 1001 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_006246.2 | Gene: | PRKCH / 5583 | HGNCID: | 9403 | Length: | 683 | Species: | Homo sapiens |
Alignment Length: | 312 | Identity: | 61/312 - (19%) |
---|---|---|---|
Similarity: | 97/312 - (31%) | Gaps: | 108/312 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 761 HKMEIYTFDAPTTCRHCSKFLKGRIHQGYRCKVCQISVHKGCISSTG-RCKQNPVSVPPPVCDRQ 824
Fly 825 L-------------------------SEFNWFAGNMDRETAAHRLENRRI---GTY----LLRVR 857
Fly 858 PQGPSTAHETMYALSLKTDDNVIK-------------------HMKINQ---------------- 887
Fly 888 -ENSGDSMLYCLSSRR--------HFKTIVELVSYYERNDLGENFAGLNQSLQWPYKEVIATALY 943
Fly 944 DYEPKAGSNQLQLRTDCQVLVIG--KDGDSKGWWRGKIGDTVGYFPKEYVQE 993 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Vav | NP_001097030.1 | CH | 20..132 | CDD:278723 | |
RhoGEF | 428..603 | CDD:279015 | |||
PH_Vav | 624..753 | CDD:269930 | |||
PH | 641..749 | CDD:278594 | |||
C1_1 | 761..804 | CDD:278556 | 18/42 (43%) | ||
SH2_Vav_family | 824..934 | CDD:198193 | 27/185 (15%) | ||
SH3 | 940..993 | CDD:302595 | 11/54 (20%) | ||
PRKCH | NP_006246.2 | C2_PKC_epsilon | 8..140 | CDD:175981 | |
C1_1 | 172..225 | CDD:278556 | |||
C1_1 | 246..298 | CDD:278556 | 19/51 (37%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 320..342 | 2/21 (10%) | |||
S_TKc | 355..614 | CDD:214567 | 36/203 (18%) | ||
STKc_nPKC_eta | 359..681 | CDD:270742 | 35/199 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |