DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vav and PRKCB

DIOPT Version :9

Sequence 1:NP_001097030.1 Gene:Vav / 32920 FlyBaseID:FBgn0040068 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_002729.2 Gene:PRKCB / 5579 HGNCID:9395 Length:673 Species:Homo sapiens


Alignment Length:301 Identity:61/301 - (20%)
Similarity:108/301 - (35%) Gaps:95/301 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   761 HKMEIYTFDAPTTCRHCSKFLKGRIHQGYRCKVCQISVHKGCISSTGRCKQNPVSVPPPVCDRQL 825
            ||.:|:|:.:||.|.||...|.|.||||.:|..|.::|||.|:.:.           |.:|....
Human   102 HKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNV-----------PSLCGTDH 155

  Fly   826 SEFN---WFAGNMDRETAAHRLENRRIGTYLLRVRPQGPSTAHETMYALSLKTDDNVIKHMKIN- 886
            :|..   :...::||:.....:.:.:      .:.|..|:...:....|.|..|.......|.. 
Human   156 TERRGRIYIQAHIDRDVLIVLVRDAK------NLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKT 214

  Fly   887 -----------------QENSGDSML------YCLSSRRHF------------KTIVE----LVS 912
                             :|:..|..|      :.|:||..|            |..|:    |:|
Human   215 IKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLS 279

  Fly   913 YYE---------------RNDLGENF--AGLNQSLQWPYKEVIATALYDYEPKAGSNQLQLRTDC 960
            ..|               ..:|.:.|  |.::|..:.| :|.....:..::.....::::|....
Human   280 QEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVP-EEKTTNTVSKFDNNGNRDRMKLTDFN 343

  Fly   961 QVLVIGKDGDSKGWWRGKIGDTVGYFPKEYVQEQKLASEEL 1001
            .::|:||                |.|.|..:.|:| .::||
Human   344 FLMVLGK----------------GSFGKVMLSERK-GTDEL 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VavNP_001097030.1 CH 20..132 CDD:278723
RhoGEF 428..603 CDD:279015
PH_Vav 624..753 CDD:269930
PH 641..749 CDD:278594
C1_1 761..804 CDD:278556 21/42 (50%)
SH2_Vav_family 824..934 CDD:198193 25/169 (15%)
SH3 940..993 CDD:302595 7/52 (13%)
PRKCBNP_002729.2 C1_cPKC_rpt1 35..92 CDD:410383
C1_cPKC_rpt2 102..155 CDD:410386 23/63 (37%)
C2_PKC_alpha_gamma 159..289 CDD:175992 20/135 (15%)
STKc_cPKC_beta 341..663 CDD:270767 10/44 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.