DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vav and prkd1

DIOPT Version :9

Sequence 1:NP_001097030.1 Gene:Vav / 32920 FlyBaseID:FBgn0040068 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_005158873.1 Gene:prkd1 / 557123 ZFINID:ZDB-GENE-080131-1 Length:886 Species:Danio rerio


Alignment Length:283 Identity:63/283 - (22%)
Similarity:101/283 - (35%) Gaps:87/283 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   761 HKMEIYTFDAPTTCRHCSKFLKGRIHQGYRCKVCQISVHKGCI-----SSTGRCKQN-PVSVPPP 819
            |...|:::..||.|:||.|.|||...||.:||.|:.:.||.|.     :..|...:| .:..|..
Zfish   245 HTFVIHSYTRPTVCQHCKKLLKGLFRQGLQCKDCKFNCHKRCAPKVPNNCLGEVSRNGDLLSPGA 309

  Fly   820 VCDRQLSEFNWFAGNMDRETAAHR-----LENRRIG---TYLLRVRPQGPSTAH----------- 865
            ..|..:.|     |..|.:...|.     :|...:|   .||        ...|           
Zfish   310 ESDVVMEE-----GCDDHDGDRHSPLIDDMEESLVGDSAAYL--------EAGHGELGDFQDLDP 361

  Fly   866 -ETMYALSLKTDDNV--------IKHMKINQEN-----------SGDSMLYCLSSRRHFKTIVEL 910
             |:...:|..|.:|:        :||.|....|           |.|:    |..|.:::...:.
Zfish   362 DESNRIISPSTSNNIPLMRVVQSVKHTKRKSSNVMKEGWLVHFTSKDT----LRKRHYWRLDSKC 422

  Fly   911 VSYYERNDLGENFAGLNQSLQWPYKEVIATALYDYEPKAGSNQL---------QLRTDCQVLVIG 966
            ::.:: ||.|..:          |||:..:.:...||....|.|         ::.|...|..:|
Zfish   423 ITLFQ-NDTGSKY----------YKEIPLSEVLSLEPAKTFNLLPEGANPHCFEIATTSLVYYVG 476

  Fly   967 K-----DGDSKGWWRGKIGDTVG 984
            :     ||.|.|:....:...||
Zfish   477 ENLSRADGGSSGYGSSMLVSGVG 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VavNP_001097030.1 CH 20..132 CDD:278723
RhoGEF 428..603 CDD:279015
PH_Vav 624..753 CDD:269930
PH 641..749 CDD:278594
C1_1 761..804 CDD:278556 19/47 (40%)
SH2_Vav_family 824..934 CDD:198193 24/148 (16%)
SH3 940..993 CDD:302595 13/59 (22%)
prkd1XP_005158873.1 C1_1 114..163 CDD:278556
C1 245..294 CDD:237996 19/48 (40%)
PH_PKD 388..517 CDD:269945 25/127 (20%)
STKc_PKD 553..812 CDD:270984
S_TKc 561..813 CDD:214567
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.