DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vav and ARHGEF40

DIOPT Version :9

Sequence 1:NP_001097030.1 Gene:Vav / 32920 FlyBaseID:FBgn0040068 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_011535239.1 Gene:ARHGEF40 / 55701 HGNCID:25516 Length:1523 Species:Homo sapiens


Alignment Length:744 Identity:155/744 - (20%)
Similarity:267/744 - (35%) Gaps:235/744 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 PTMLYD-----------LTNFHRVLITLSKLSQC-RKVQQLHPDLIGFNLQLSPTERSHSDEAIY 165
            |..||.           |:|.|   :...:..|| |::||:...|.|      |.|...:..|:.
Human   755 PATLYQEVDEAIHQLVRLSNLH---VQQQEQRQCLRRLQQVLQWLSG------PGEEQLASFAMP 810

  Fly   166 KD----LHSTDLNMRKTSSIDASASSSAEYYDRTSQSG---SLDENS------DI------TIEN 211
            .|    |..|:|..|         :.|||..:|.:|:.   :|:||:      ||      .:|:
Human   811 GDTLSALQETELRFR---------AFSAEVQERLAQAREALALEENATSQKVLDIFEQRLEQVES 866

  Fly   212 GT----------EDIDDYIEDSLSNMCDSTIDNDAEDAGV---ETPLLSDCQGSHVRELSFDLAL 263
            |.          :...:::::..:.:..:....:|..|.:   ..|..|......:|.|:.||  
Human   867 GLHRALRLQRFFQQAHEWVDEGFARLAGAGPGREAVLAALALRRAPEPSAGTFQEMRALALDL-- 929

  Fly   264 DVVSSTTDGASNAV-----------------------TPTPESYARQSQSPLAAAAPSVPVSAAP 305
                    |:..|:                       ..:|..|.|:.    |..|.|......|
Human   930 --------GSPAALREWGRCQARCQELERRIQQHVGEEASPRGYRRRR----ADGASSGGAQWGP 982

  Fly   306 GPPMGRLVSTSSSSSSLLVSESQRLQRAAAAVYNYRSSMASTEHEYAYIYSEDDEKVYEDLCYVT 370
            ..|       |.|.||||:..|...:.|.:     ..|:|....:|.   .|..|...|      
Human   983 RSP-------SPSLSSLLLPSSPGPRPAPS-----HCSLAPCGEDYE---EEGPELAPE------ 1026

  Fly   371 FQAKAKP---------EVTTDNIACNGTGYDHTNTKEEEVYQDLCALHR---------TSRSQTA 417
              |:.:|         |||:..:.      |.|.:..|.|   |....|         |.|.:..
Human  1027 --AEGRPPRAVLIRGLEVTSTEVV------DRTCSPREHV---LLGRARGPDGPWGVGTPRMERK 1080

  Fly   418 SSTSFEQRDYVIRELIDTESNYLDVLT--------ALKTKFMGPLERHLNQDELRLIFPRIRELV 474
            .|.|.:||  ::.|||..|.:|:..|:        .|..:..|.....|:..|....|.|     
Human  1081 RSISAQQR--LVSELIACEQDYVATLSEPVPPPGPELTPELRGTWAAALSARERLRSFHR----- 1138

  Fly   475 DIHTKFLDKLRESLTPNAKVKMAQVFLDFREPFLIYGEFCS---LLLGAIDYLADVCKKNQIIDQ 536
               |.||.:|:...|  ..:::...||...:.|.:|.::..   .|...:..|:.:.|       
Human  1139 ---THFLRELQGCAT--HPLRIGACFLRHGDQFSLYAQYVKHRHKLENGLAALSPLSK------- 1191

  Fly   537 LVQKCERDYNVGKLQ----LRDILSVPMQRILKYHLLLDKLVKETSP-LHDDYRSLERAKEAMID 596
                       |.::    |...|..|::::.:|..||::|::|..| |..:.|:|..|      
Human  1192 -----------GSMEAGPYLPRALQQPLEQLTRYGRLLEELLREAGPELSSECRALGAA------ 1239

  Fly   597 VSQYINEVKRDSDHLVIIQKVKDSICDIHLLQNGNGSDLLQYGRLLLDGELHIKAHED------- 654
             .|.:.|.:.....|:.::.|:.  |:|         ||.:.|:||         |.|       
Human  1240 -VQLLREQEARGRDLLAVEAVRG--CEI---------DLKEQGQLL---------HRDPFTVICG 1283

  Fly   655 QKTKLRYAFVFDKILIMVKALHIKTGDMQYTYRDSHNLADYRVEQSHSRRTIGRDTRFKYQLLLA 719
            :|..||:.|:|:.:|:..|....:.|...:.|:.:...||..:.::     || |:...::|...
Human  1284 RKKCLRHVFLFEHLLLFSKLKGPEGGSEMFVYKQAFKTADMGLTEN-----IG-DSGLCFELWFR 1342

  Fly   720 RKSGKTAFTLYLKSEHERDKWRKALTEAM 748
            |:..:.|:||...|...:.||..::.:.:
Human  1343 RRRAREAYTLQATSPEIKLKWTSSIAQLL 1371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VavNP_001097030.1 CH 20..132 CDD:278723 6/29 (21%)
RhoGEF 428..603 CDD:279015 39/190 (21%)
PH_Vav 624..753 CDD:269930 30/132 (23%)
PH 641..749 CDD:278594 26/115 (23%)
C1_1 761..804 CDD:278556
SH2_Vav_family 824..934 CDD:198193
SH3 940..993 CDD:302595
ARHGEF40XP_011535239.1 SPEC 786..964 CDD:295325 36/202 (18%)
RhoGEF 1086..1245 CDD:295373 41/195 (21%)
PH_puratrophin-1 1244..1379 CDD:270062 34/154 (22%)
PH 1269..1367 CDD:278594 27/112 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.