DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Vav and lrch2

DIOPT Version :9

Sequence 1:	NP_001097030.1	Gene:	Vav / 32920	FlyBaseID:	FBgn0040068	Length:	1001	Species:	Drosophila melanogaster
Sequence 2:	NP_001016380.1	Gene:	lrch2 / 549134	XenbaseID:	XB-GENE-5753506	Length:	748	Species:	Xenopus tropicalis

Alignment Length:	110	Identity:	28/110 - (25%)
Similarity:	48/110 - (43%)	Gaps:	22/110 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly    29 TRCKVIPPDHKAAQPDAEIRILAMTLRDGVLLCNLVIHLDPSSL------DPREFNRKPQMAQFL 87
            :|.|||.|:.           :...|.|||:||:|..|:.|.|:      .|    ..|:::...
Frog   641 SRLKVILPED-----------IGAALMDGVVLCHLANHIRPRSVGSIHVPSP----AVPKLSMAK 690

  Fly    88 CSKNIKLFLDVCHNNFGIRDADLFEPTMLYDLTNFHRVLITLSKL 132
            |.:|::.||:.| ...|:....|..|..:.:.....:|.:|:..|
Frog   691 CRRNVENFLEAC-KKLGVPQDHLCLPHHILEERGLVKVGVTVQAL 734

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Vav	NP_001097030.1	CH	20..132	CDD:278723	27/108 (25%)
		RhoGEF	428..603	CDD:279015
		PH_Vav	624..753	CDD:269930
		PH	641..749	CDD:278594
		C1_1	761..804	CDD:278556
		SH2_Vav_family	824..934	CDD:198193
		SH3	940..993	CDD:302595
lrch2	NP_001016380.1	leucine-rich repeat	79..99	CDD:275380
		leucine-rich repeat	100..121	CDD:275380
		LRR_RI	<123..237	CDD:238064
		LRR_4	123..160	CDD:289563
		leucine-rich repeat	123..145	CDD:275380
		LRR_8	146..224	CDD:290566
		leucine-rich repeat	146..161	CDD:275380
		leucine-rich repeat	168..190	CDD:275380
		leucine-rich repeat	191..213	CDD:275380
		LRR_8	213..269	CDD:290566
		leucine-rich repeat	214..234	CDD:275380
		leucine-rich repeat	236..258	CDD:275380
		leucine-rich repeat	259..277	CDD:275380
		CH	627..734	CDD:278723	27/108 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910