powered by:
Protein Alignment Vav and PEX13
DIOPT Version :9
Sequence 1: | NP_001097030.1 |
Gene: | Vav / 32920 |
FlyBaseID: | FBgn0040068 |
Length: | 1001 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_002609.1 |
Gene: | PEX13 / 5194 |
HGNCID: | 8855 |
Length: | 403 |
Species: | Homo sapiens |
Alignment Length: | 73 |
Identity: | 19/73 - (26%) |
Similarity: | 30/73 - (41%) |
Gaps: | 7/73 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 926 LNQSLQWPYKE---VIATALYDYEPKAGSNQLQLRTDCQVLVIGKDGDSK--GWWRGKI-GDTVG 984
:..|:.|...| |:|.|.||: ......::..|....:.:..|:...| ||....: |.|.|
Human 261 VTDSINWASGEDDHVVARAEYDF-AAVSEEEISFRAGDMLNLALKEQQPKVRGWLLASLDGQTTG 324
Fly 985 YFPKEYVQ 992
..|..||:
Human 325 LIPANYVK 332
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1291 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.