DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vav and pex13

DIOPT Version :9

Sequence 1:NP_001097030.1 Gene:Vav / 32920 FlyBaseID:FBgn0040068 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_956939.1 Gene:pex13 / 393618 ZFINID:ZDB-GENE-040426-1544 Length:416 Species:Danio rerio


Alignment Length:331 Identity:57/331 - (17%)
Similarity:97/331 - (29%) Gaps:118/331 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 SNAVTPTPESYARQSQSPLAAAAPSVPVSAAPGPPMGRLVSTSSSSSSLLVSESQRLQRAAAAVY 338
            :..|.|.|....|||..|..::.||   |.:|                                 
Zfish    45 TRVVPPIPPRPVRQSYRPTYSSFPS---SYSP--------------------------------- 73

  Fly   339 NYRSSMASTEHEYAYI-YSEDDEKVYEDLCYVTFQAKAKPEVTTDNIACNGTGYDHTNTKEE--- 399
             |.:||......|:|. |.                            ...|.||:..||.:|   
Zfish    74 -YGNSMYGGYSPYSYSGYG----------------------------VGGGLGYNRFNTMDEIPP 109

  Fly   400 ------------EVYQDL-CALHRTSRSQTASSTSFEQRDYVIRELIDTESNYLDVLTALKTKFM 451
                        ..:|.: ..:|..|........:|.......|.::|..:::    :.|:..|.
Zfish   110 SRFVQQAEESSRGAFQSIESIVHAFSSVSMMMDATFSAVYNSFRAVLDVANHF----SRLRIHFT 170

  Fly   452 GPLERHLNQDELRLIFPRIRELV------DIHTKFLDKLRESLTPNA--------------KVKM 496
            ..|........||.::.|::.|:      ::...:.|....|...:|              .||.
Zfish   171 KVLSAFALVRTLRYLYRRLQRLMGLRQGSEVDDLWADSAASSSVVSASGARGAGVEEPGVNSVKS 235

  Fly   497 AQVFLDFR----EPFLIYGEFCSLLLGAIDYLADVCKKNQIIDQLVQKCERDYNVG-----KLQL 552
            ..:||.|.    .|:||: ...|...||.:...:......  |.:|.:.|.|:...     .:|.
Zfish   236 WPIFLFFAVVLGGPYLIW-RLLSSAEGAEENATNWASGED--DHVVARVEYDFTAASEEEISVQA 297

  Fly   553 RDILSV 558
            .|:|::
Zfish   298 GDMLNL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VavNP_001097030.1 CH 20..132 CDD:278723
RhoGEF 428..603 CDD:279015 30/160 (19%)
PH_Vav 624..753 CDD:269930
PH 641..749 CDD:278594
C1_1 761..804 CDD:278556
SH2_Vav_family 824..934 CDD:198193
SH3 940..993 CDD:302595
pex13NP_956939.1 Peroxin-13_N 108..256 CDD:282008 24/152 (16%)
SH3_PEX13_eumet 278..335 CDD:212798 6/26 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.