DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Vav and Lrch1

DIOPT Version :9

Sequence 1:	NP_001097030.1	Gene:	Vav / 32920	FlyBaseID:	FBgn0040068	Length:	1001	Species:	Drosophila melanogaster
Sequence 2:	XP_006519217.3	Gene:	Lrch1 / 380916	MGIID:	2443390	Length:	877	Species:	Mus musculus

Alignment Length:	114	Identity:	35/114 - (30%)
Similarity:	53/114 - (46%)	Gaps:	20/114 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly    50 LAMTLRDGVLLCNLVIHLDPSSL------DPREFNRKPQMAQFLCSKNIKLFLDVCHNNFGIRDA 108
            |...|.|||:||:|..|:.|.|:      .|    ..|:::...|.:|::.||:.| ...|:.:|
Mouse   751 LGAALMDGVVLCHLANHVRPRSVASIHVPSP----AVPKLSMAKCRRNVENFLEAC-RKLGVPEA 810

  Fly   109 DLFEP--TMLYDLTNFHRVLITLSKLSQCRKVQQ-----LHPDLIGFNL 150
            ||..|  .:..|..:..:.:.||..|.:  |..|     ...|||||.|
Mouse   811 DLCSPYDILQLDFRHIRKTVDTLLALGE--KPPQSTSALRSRDLIGFCL 857

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Vav	NP_001097030.1	CH	20..132	CDD:278723	26/89 (29%)
		RhoGEF	428..603	CDD:279015
		PH_Vav	624..753	CDD:269930
		PH	641..749	CDD:278594
		C1_1	761..804	CDD:278556
		SH2_Vav_family	824..934	CDD:198193
		SH3	940..993	CDD:302595
Lrch1	XP_006519217.3	PRK15370	<162..>365	CDD:185268
		leucine-rich repeat	167..189	CDD:275380
		leucine-rich repeat	190..212	CDD:275380
		leucine-rich repeat	213..235	CDD:275380
		leucine-rich repeat	236..251	CDD:275380
		leucine-rich repeat	258..280	CDD:275380
		leucine-rich repeat	281..303	CDD:275380
		leucine-rich repeat	304..324	CDD:275380
		leucine-rich repeat	326..348	CDD:275380
		leucine-rich repeat	349..368	CDD:275380
		leucine-rich repeat	376..387	CDD:275378
		CH	729..818	CDD:214479	23/71 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910