DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vav and GEFmeso

DIOPT Version :9

Sequence 1:NP_001097030.1 Gene:Vav / 32920 FlyBaseID:FBgn0040068 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_788403.2 Gene:GEFmeso / 37134 FlyBaseID:FBgn0050115 Length:1549 Species:Drosophila melanogaster


Alignment Length:580 Identity:136/580 - (23%)
Similarity:216/580 - (37%) Gaps:150/580 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 AEYYDR--TSQSGSLDENSDITIENGTEDIDDYIEDSLSNMCDSTIDNDAEDAGVETPLLSDCQG 251
            |::.:|  .:..|.||..:::........::..:..|.|..|.|||        ..:|||     
  Fly   368 AQHMERLTLADPGDLDPRAELIEAVNKTLVNKPLVRSSSAACASTI--------CSSPLL----- 419

  Fly   252 SHVRELSFDLALDVVSSTTDGASNAVTPTPESYA------RQSQSPLAAAAPSVPVSAAPGPPMG 310
            ::.|..|    |...:||..|......||.|..|      :.|...|.......|..||....:.
  Fly   420 TYARTKS----LGAKASTLGGGVPIKLPTAEQLAELEEANKLSAESLDRLTDIKPKFAARLSELA 480

  Fly   311 RL----------VSTSSSSSSLLVSESQRLQRAAAAVYNYRS---SMASTEHEYAYIYSEDDEKV 362
            ||          .|||||||    |.|.:|........:|.:   |:|.:|:|....:......|
  Fly   481 RLNNRPLSSSSICSTSSSSS----SGSDQLLNGKLMATSYLASVESLAESENELGDQHHPPAMSV 541

  Fly   363 YEDLCYVTFQAKAKPEVTTDNIACNGTGYDHTNTKEEEVYQDLCALHRTSRSQTASSTSFEQRDY 427
            .|..|.                                                           
  Fly   542 LEKTCL----------------------------------------------------------- 547

  Fly   428 VIRELIDTESNYL-DVLTALKTKFMGPLERH-LNQDELRLIFPRIRELVDIHTKFLDKLRESLTP 490
               |::|:|.::: |:...:|.......||. |..|||:::|..|.|:.:.::..|.:|..  |.
  Fly   548 ---EIVDSERSFVEDLGQVIKGYLQDWKERACLRVDELQILFANIEEIYEFNSMLLQRLIN--TG 607

  Fly   491 NAKVKMAQVFLDFREPFLIYGEFCSLLLGAIDYLADVCKKNQIIDQL--VQKCERDYNVGKLQLR 553
            ....::|:.|:|.|:.|.:|..:|:....||..|..:.:.......|  .||..:.    :|.|.
  Fly   608 RDPGRIARCFIDLRDGFDVYTTYCTSYPEAISLLTKLLQATHTYSLLASTQKLLQH----RLPLG 668

  Fly   554 DILSVPMQRILKYHLLLDKLVKETSPLHDDYRSLERAKEAMIDVSQYINEVKRDSDHLVIIQKVK 618
            ..|..|:|||||||||||.|.|     |.|.:.:..|...|..|:..|::|||..:....::::.
  Fly   669 SYLLKPVQRILKYHLLLDSLRK-----HCDVKEVVEAHVIMRQVAHNIDQVKRKQEQQSRVKELS 728

  Fly   619 DSICDIHLLQNGNGSDLLQYGRLLLDGELHIKAHEDQKTKLRYAFVFDKILIMVKALHIKTGDMQ 683
            .      :|....|.:|...|.|..:|.|     .:|..|.|...:|..:||:.|  ..:.|.:|
  Fly   729 G------ILDGWLGPELTVLGELRQEGLL-----MEQHNKQRLVLLFATMLIITK--QKEDGRLQ 780

  Fly   684 Y-TYRDSHNLADYRVEQSHSRRTIGRDTRF--------KYQL-LLAR-KSGKTAFTLYLK 732
            : ||...:||       ..|....|..|.|        ::|: |.|| :..|..:|.::|
  Fly   781 FKTYISQNNL-------MLSEHLPGEPTSFYVIPFDEPRHQIKLTARNRDQKRIWTQHIK 833

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VavNP_001097030.1 CH 20..132 CDD:278723
RhoGEF 428..603 CDD:279015 53/178 (30%)
PH_Vav 624..753 CDD:269930 31/120 (26%)
PH 641..749 CDD:278594 27/103 (26%)
C1_1 761..804 CDD:278556
SH2_Vav_family 824..934 CDD:198193
SH3 940..993 CDD:302595
GEFmesoNP_788403.2 RhoGEF 548..713 CDD:279015 53/175 (30%)
PH_PLEKHG1_G2_G3 694..839 CDD:270063 38/160 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462292
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.