Sequence 1: | NP_001097030.1 | Gene: | Vav / 32920 | FlyBaseID: | FBgn0040068 | Length: | 1001 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_523776.1 | Gene: | POSH / 36990 | FlyBaseID: | FBgn0040294 | Length: | 838 | Species: | Drosophila melanogaster |
Alignment Length: | 269 | Identity: | 60/269 - (22%) |
---|---|---|---|
Similarity: | 102/269 - (37%) | Gaps: | 77/269 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 772 TTCRHCSKFLKGRIHQGYRCKVCQISVHKGCISSTGRCKQNPVSVPPPVCDRQLSEFNWFAGNMD 836
Fly 837 RETAAHRLENR--RIGTYLLRVRPQGPSTAHETMYALSLKTDDNVIKHMKINQENSGDSMLYCLS 899
Fly 900 SRR----HFKTIVELVS------YYERNDL-----------------GE------NFAGLNQSLQ 931
Fly 932 WPYKEVIATALYDYEPKAGSNQ----LQLRTDCQVLVIGKDGDSKGWWRGKIGDTVGYFPKEYVQ 992
Fly 993 EQKLASEEL 1001 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Vav | NP_001097030.1 | CH | 20..132 | CDD:278723 | |
RhoGEF | 428..603 | CDD:279015 | |||
PH_Vav | 624..753 | CDD:269930 | |||
PH | 641..749 | CDD:278594 | |||
C1_1 | 761..804 | CDD:278556 | 10/31 (32%) | ||
SH2_Vav_family | 824..934 | CDD:198193 | 24/144 (17%) | ||
SH3 | 940..993 | CDD:302595 | 17/56 (30%) | ||
POSH | NP_523776.1 | RING | 11..53 | CDD:238093 | 7/22 (32%) |
SH3 | 139..191 | CDD:302595 | 6/51 (12%) | ||
SH3_SH3RF_2 | 199..251 | CDD:212721 | 16/59 (27%) | ||
SH3_SH3RF_3 | 424..477 | CDD:212717 | |||
SH3_SH3RF_C | 782..836 | CDD:212719 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |