DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vav and POSH

DIOPT Version :9

Sequence 1:NP_001097030.1 Gene:Vav / 32920 FlyBaseID:FBgn0040068 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_523776.1 Gene:POSH / 36990 FlyBaseID:FBgn0040294 Length:838 Species:Drosophila melanogaster


Alignment Length:269 Identity:60/269 - (22%)
Similarity:102/269 - (37%) Gaps:77/269 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   772 TTCRHCSKFLKGRIHQGYRCKVCQISVHKGCISSTGRCKQNPVSVPPPVCDRQLSEFNWFAGNMD 836
            |.||.|.:.:....|: .||..|:|.|         .||.:  .:||.|...::.|      .|.
  Fly    31 TFCRKCLQDIVASQHK-LRCPECR
ILV---------SCKID--ELPPNVLLMRILE------GMK 77

  Fly   837 RETAAHRLENR--RIGTYLLRVRPQGPSTAHETMYALSLKTDDNVIKHMKINQENSGDSMLYCLS 899
            :..||.:.|.:  ...|...|.:||.|        |.|:...||.:..::.:|::...:.   ..
  Fly    78 QNAAAGKGEEKGEETETQPERAKPQPP--------AESVAPPDNQLLQLQSHQQSHQPAR---HK 131

  Fly   900 SRR----HFKTIVELVS------YYERNDL-----------------GE------NFAGLNQSLQ 931
            .||    |...:.:..|      .:::.||                 |:      |:..::..|.
  Fly   132 QRRFLLPHAYALFDFASGEATDLKFKKGDLILIKHRIDNNWFVGQANGQEGTFPINYVKVSVPLP 196

  Fly   932 WPYKEVIATALYDYEPKAGSNQ----LQLRTDCQVLVIGKDGDSKGWWRGKIGDTVGYFPKEYVQ 992
            .|.    ..|:||:  |.|.|.    |:.:....:.|:.:  ....|..|:||.|:|.||..:| 
  Fly   197 MPQ----CIAMYDF--KMGPNDEEGCLEFKKSTVIQVMRR--VDHNWAEGRIGQTIGIFPIAFV- 252

  Fly   993 EQKLASEEL 1001
            |...|:::|
  Fly   253 ELNAAAKKL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VavNP_001097030.1 CH 20..132 CDD:278723
RhoGEF 428..603 CDD:279015
PH_Vav 624..753 CDD:269930
PH 641..749 CDD:278594
C1_1 761..804 CDD:278556 10/31 (32%)
SH2_Vav_family 824..934 CDD:198193 24/144 (17%)
SH3 940..993 CDD:302595 17/56 (30%)
POSHNP_523776.1 RING 11..53 CDD:238093 7/22 (32%)
SH3 139..191 CDD:302595 6/51 (12%)
SH3_SH3RF_2 199..251 CDD:212721 16/59 (27%)
SH3_SH3RF_3 424..477 CDD:212717
SH3_SH3RF_C 782..836 CDD:212719
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.