DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vav and Stac3

DIOPT Version :9

Sequence 1:NP_001097030.1 Gene:Vav / 32920 FlyBaseID:FBgn0040068 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_001124030.1 Gene:Stac3 / 362895 RGDID:1308964 Length:361 Species:Rattus norvegicus


Alignment Length:288 Identity:61/288 - (21%)
Similarity:102/288 - (35%) Gaps:65/288 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   723 GKTAFTLYLKSEHERDKWRKALTEAMESLEPPG-CQSTDHKMEIYTFDAPTTCRHCSKFLKGRIH 786
            |...:.:|.:.|.|.:       |.....|||. .....||.:.:.|..|..|..|::.:.....
  Rat    57 GGPIYYIYEEEEEEEE-------EEEPPPEPPKLVNDKPHKFKDHFFKKPKFCDVCARMIVLNNK 114

  Fly   787 QGYRCKVCQISVHKGCISSTGRCKQNPVSVPPPVCDRQLSEFNWFAGNMDRETAAHR----LENR 847
            .|.|||.|:.::|:.|.|...  .|......||...|..|...:........:||:|    .|..
  Rat   115 FGLRCKNCKTNIHEHCQSYVE--MQKCFGKIPPGFHRAYSSPLYSNQQYACVSAANRNDPVFETL 177

  Fly   848 RIGTYLL-RVRPQGPSTAHETMYAL-----------SLKTDD--NVIKHMKINQENSGDSMLYCL 898
            |:|..:. :.|.:|.:.....:.|:           ..|:.|  :..|..|..::...|......
  Rat   178 RVGVIMANKERKKGQADKKNPLAAMMEEEPESARPEEGKSQDGNDAEKDKKAEKKTPDDKNKQPG 242

  Fly   899 SSRRHFKTIVELVSYYERNDLGENFAGLNQSLQWPYKEVIATALYDYEPKAGSNQLQLRTDCQVL 963
            ..:.|:...:......|::||                        |:.|..           ::.
  Rat   243 FQQSHYFVALYRFKALEKDDL------------------------DFPPGE-----------KIT 272

  Fly   964 VIGKDGDSKGWWRGKIGDTVGYFPKEYV 991
            ||  |..::.|||||||:.||:||..::
  Rat   273 VI--DDSNEEWWRGKIGEKVGFFPPNFI 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VavNP_001097030.1 CH 20..132 CDD:278723
RhoGEF 428..603 CDD:279015
PH_Vav 624..753 CDD:269930 5/29 (17%)
PH 641..749 CDD:278594 5/25 (20%)
C1_1 761..804 CDD:278556 13/42 (31%)
SH2_Vav_family 824..934 CDD:198193 19/127 (15%)
SH3 940..993 CDD:302595 16/52 (31%)
Stac3NP_001124030.1 C1_1 89..134 CDD:278556 14/44 (32%)
STAC2_u1 146..>218 CDD:293269 12/71 (17%)
SH3_Stac3_1 248..300 CDD:212919 19/88 (22%)
SH3_Stac_2 307..357 CDD:212768
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.