DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vav and Dgk

DIOPT Version :9

Sequence 1:NP_001097030.1 Gene:Vav / 32920 FlyBaseID:FBgn0040068 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_724619.2 Gene:Dgk / 35738 FlyBaseID:FBgn0085390 Length:1230 Species:Drosophila melanogaster


Alignment Length:236 Identity:51/236 - (21%)
Similarity:80/236 - (33%) Gaps:53/236 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   609 DHLVIIQKVKDSICDIHLLQNGNGSDLLQYGRLLLDGELHIKAHEDQKTKLRYAFVFDKILIMVK 673
            |.|.:...:||.:|.:.||:.|...|.|::...|.|.:.:              .|.|       
  Fly   291 DPLTLKVPLKDVVCYLSLLEAGRPEDKLEFMFRLYDTDSN--------------GVLD------- 334

  Fly   674 ALHIKTGDMQYTYRDSHNLADYRVEQSHSRRTIGRDT---RFKYQLLLARKSGKTAFTLYLKSEH 735
                 |.:|.........:|:|          :|.|.   |...|.::.........|:.|    
  Fly   335 -----TAEMDAIVNQMMAVAEY----------LGWDVSELRPILQEMMVEIDYDADGTVSL---- 380

  Fly   736 ERDKWRKALTEAMESLEPPGCQSTD------HKMEIYTFDAPTTCRHCSKFLKGRIHQGYRCKVC 794
              |:|::.....:..|...|..||.      |...:..|..|..|..|...|.|...:|..|.:|
  Fly   381 --DEWQRGGMTTIPLLVLLGVDSTTLKEDGIHVWRLKHFSKPAYCNLCLNMLVGLGKKGLCCVLC 443

  Fly   795 QISVHKGCIS-STGRCKQNPVSVPPPVCDRQLSEFNWFAGN 834
            :.:||:.|:. :...|....|....|.|...|.. :|..||
  Fly   444 KYTVHERCVQHAPASCITTYVKSKKPKCGGDLLH-HWVEGN 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VavNP_001097030.1 CH 20..132 CDD:278723
RhoGEF 428..603 CDD:279015
PH_Vav 624..753 CDD:269930 22/131 (17%)
PH 641..749 CDD:278594 16/110 (15%)
C1_1 761..804 CDD:278556 13/42 (31%)
SH2_Vav_family 824..934 CDD:198193 4/11 (36%)
SH3 940..993 CDD:302595
DgkNP_724619.2 DAG_kinase_N 9..313 CDD:291199 7/21 (33%)
EFh 317..386 CDD:238008 17/110 (15%)
EF-hand_7 318..382 CDD:290234 15/105 (14%)
C1 410..459 CDD:237996 13/48 (27%)
C1_1 477..528 CDD:278556 3/8 (38%)
DAGKc 573..694 CDD:214487
DAGKa 1003..1194 CDD:214486
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.