DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vav and soem-1

DIOPT Version :10

Sequence 1:NP_001097030.1 Gene:Vav / 32920 FlyBaseID:FBgn0040068 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_001021833.1 Gene:soem-1 / 3565861 WormBaseID:WBGene00013603 Length:190 Species:Caenorhabditis elegans


Alignment Length:86 Identity:32/86 - (37%)
Similarity:48/86 - (55%) Gaps:12/86 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   834 NMDRETAAHRLENRRIGTYLLRVRPQGPSTAHETMYALSLKTDDNVIKHMKINQENSGDSMLYCL 898
            ||:|..|..|||||.:|.||||.|.:|.:       ||||:....|: |:||  |.:|:.  :.:
 Worm   100 NMNRVEAEKRLENRNLGDYLLRSRGEGSA-------ALSLRATKGVV-HIKI--EWNGEK--WVI 152

  Fly   899 SSRRHFKTIVELVSYYERNDL 919
            .....|::|...:|:|.|:.|
 Worm   153 GEGPLFRSISSAISFYRRHPL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VavNP_001097030.1 CH_VAV 19..135 CDD:409050
RhoGEF 428..602 CDD:459876
PH_Vav 624..753 CDD:269930
C1_VAV 759..810 CDD:410360
SH2_Vav_family 824..934 CDD:198193 32/86 (37%)
SH3 940..993 CDD:473055
soem-1NP_001021833.1 SH2 100..173 CDD:472789 31/84 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.