DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vav and STAC2

DIOPT Version :9

Sequence 1:NP_001097030.1 Gene:Vav / 32920 FlyBaseID:FBgn0040068 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_016880069.1 Gene:STAC2 / 342667 HGNCID:23990 Length:416 Species:Homo sapiens


Alignment Length:358 Identity:84/358 - (23%)
Similarity:126/358 - (35%) Gaps:114/358 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   711 RFKYQLLLAR-KSGKTAFTLYLKSEHERDKWRKALTEAMESLEPPGCQSTD-------------- 760
            |||..|.|.. ...|:....:|:|..|.....:.|......|.||....|.              
Human    33 RFKRSLSLKTILRSKSLENFFLRSGSELKCPTEVLLTPPTPLPPPSPPPTASDRGLATPSPSPCP 97

  Fly   761 -------------HKMEIYTFDAPTTCRHCSKFLKGRIHQGYRCKVCQISVHKGC---------- 802
                         |..:.:.|...:.|..|.:.:.|...||.|||:|::|||..|          
Human    98 VPRPLAALKPVRLHSFQEHVFKRASPCELCHQLIVGNSKQGLRCKMCKVSVHLWCSEEISHQQCP 162

  Fly   803 ---ISSTGRCKQNPVSV--PPPVC-DRQLSEFNWFAGNMDRETAAHRLENRRIGTYL-LRVRPQG 860
               .:|..|...:|:.|  ||||| ..:.|.....:|.:|..     .|..|.||.| |..|...
Human   163 GKTSTSFRRNFSSPLLVHEPPPVCATSKESPPTGDSGKVDPV-----YETLRYGTSLALMNRSSF 222

  Fly   861 PSTAHETMYALSLK---TDDNVIKHMKINQENSGDS-----------------------MLYCLS 899
            .||:.....:||.:   |:|.. ..::.::|..|||                       .|...:
Human   223 SSTSESPTRSLSERDELTEDGE-GSIRSSEEGPGDSASPVFTAPAESEGPGPEEKSPGQQLPKAT 286

  Fly   900 SRRHFKTIVELVSYY-----ERNDLGENFAGLNQSLQWPYKEVIATALYDYEPKAGSNQLQLRTD 959
            .|:....:...|:.|     |.|||                     ||:...|:.|.        
Human   287 LRKDVGPMYSYVALYKFLPQENNDL---------------------ALHSVLPRPGD-------- 322

  Fly   960 CQVLVIGKDGDSKGWWRGKIGDTVGYFPKEYVQ 992
             :::::  |..::.||:|||||.||:||..:||
Human   323 -RIMLV--DDSNEDWWKGKIGDRVGFFPANFVQ 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VavNP_001097030.1 CH 20..132 CDD:278723
RhoGEF 428..603 CDD:279015
PH_Vav 624..753 CDD:269930 11/42 (26%)
PH 641..749 CDD:278594 10/38 (26%)
C1_1 761..804 CDD:278556 15/55 (27%)
SH2_Vav_family 824..934 CDD:198193 28/141 (20%)
SH3 940..993 CDD:302595 18/53 (34%)
STAC2XP_016880069.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.