DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vav and Unc-89

DIOPT Version :9

Sequence 1:NP_001097030.1 Gene:Vav / 32920 FlyBaseID:FBgn0040068 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_001097440.1 Gene:Unc-89 / 3346201 FlyBaseID:FBgn0053519 Length:4218 Species:Drosophila melanogaster


Alignment Length:357 Identity:81/357 - (22%)
Similarity:145/357 - (40%) Gaps:88/357 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 DLCYVT--FQAKAKPEVTTDNIA-------------------CNGTGYDHTNT-KEEEVYQDLCA 407
            |:.:|:  :||::   :.||.|:                   |....:|..:: ||..|..|:..
  Fly     6 DIVFVSRDYQAQS---LATDEISVSRGDLVELISSKASEKSRCFVRMFDSGDSPKEGWVPIDILE 67

  Fly   408 LHRT-SRSQTASSTSFEQRDY-VIRELIDTESNY-LDVLTALKTKFMG---PLERHLNQDELRLI 466
            .:.| |.|....|...|.|.. ::|||::||..: .|:|..::....|   |:.....:|...:|
  Fly    68 FNPTMSSSNGKESGDAEFRKLTILRELVETEEEFSRDLLHVVEKYIKGIDKPVVPRSVRDNKDII 132

  Fly   467 FPRIRELVDIHTKFLDKLRESL-----TPNAKVKMAQVFLDFREPFLIYGEFCSLLLGAIDYLAD 526
            |....::.:.|.   :.|:|.|     .||   .:|:.||.....|..:..:|.....|.|||..
  Fly   133 FCNFLQIAEFHN---NVLKEGLKCYSNQPN---MVAKTFLRLERDFDKHVVYCQNEPLAQDYLGS 191

  Fly   527 VCKKNQIIDQLVQKCERDYNVGKLQLRDILSVPMQRILKYHLLLDKLVKETSPLHDDYRSLERAK 591
            .....:...:|.::...|.:     |.:.|.:|:|||..|.||....:|.:..|.::.:.||||.
  Fly   192 SPDAKKYFQELSKQLGDDKS-----LAEHLKLPIQRINDYQLLFKDFIKYSLSLKENVKDLERAL 251

  Fly   592 EAMIDV------SQYINEVKRDSDHLVIIQKVKDSICDIHLLQNGNGSDLLQYGRLLLDGELHI- 649
            |.|:.|      :::::.::                        |...::.:.|||||....:: 
  Fly   252 ELMLSVPSRAYDNRFLSSIE------------------------GCRGNIYKLGRLLLHAWCNVV 292

  Fly   650 ----KAHEDQKTKLRYAFVFDKILIMVKALHI 677
                |||:      ||.|:|...:::.|...|
  Fly   293 DKEGKAHD------RYCFLFKSRILVTKVRKI 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VavNP_001097030.1 CH 20..132 CDD:278723
RhoGEF 428..603 CDD:279015 47/189 (25%)
PH_Vav 624..753 CDD:269930 15/59 (25%)
PH 641..749 CDD:278594 12/42 (29%)
C1_1 761..804 CDD:278556
SH2_Vav_family 824..934 CDD:198193
SH3 940..993 CDD:302595
Unc-89NP_001097440.1 RhoGEF 90..260 CDD:238091 47/180 (26%)
PH_unc89 275..388 CDD:270134 14/50 (28%)
Atrophin-1 <493..690 CDD:331285
TonB_N 502..>596 CDD:318287
I-set 1017..1108 CDD:333254
I-set 1123..1212 CDD:254352
I-set <1236..1299 CDD:333254
I-set 1313..1403 CDD:254352
Ig_3 1406..1487 CDD:316449
I-set 1499..1595 CDD:254352
I-set 1599..1690 CDD:333254
I-set 1694..1786 CDD:254352
I-set <1836..1903 CDD:333254
I-set 1922..2005 CDD:333254
I-set 2018..2108 CDD:333254
I-set 2113..2214 CDD:333254
I-set 2220..2302 CDD:254352
I-set 2318..2408 CDD:254352
I-set 2415..2506 CDD:254352
I-set 2519..2608 CDD:254352
I-set 2615..2696 CDD:254352
I-set 2717..2805 CDD:254352
FN3 2834..2925 CDD:238020
I-set <2996..3063 CDD:333254
I-set 3067..3157 CDD:333254
PK_Unc-89_rpt1 3182..3440 CDD:271011
I-set 3654..3744 CDD:333254
FN3 3748..3840 CDD:238020
STKc_Unc-89_rpt2 3893..4151 CDD:271014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.