DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vav and Syde2

DIOPT Version :9

Sequence 1:NP_001097030.1 Gene:Vav / 32920 FlyBaseID:FBgn0040068 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_017446301.2 Gene:Syde2 / 308021 RGDID:1564206 Length:1281 Species:Rattus norvegicus


Alignment Length:701 Identity:132/701 - (18%)
Similarity:214/701 - (30%) Gaps:253/701 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 TSQSGSLDENSDITIENGTEDIDDYIEDSLSNMCDSTIDNDAEDAGVETP-----LLSDCQGSHV 254
            :|::||...:.|...:.|....:...||....:.......:|..|.::.|     :||....:..
  Rat   443 SSRNGSSAFSEDDADDEGEIWYNPIPEDDSLGIAHVLSLEEANAAALKLPAVRVSMLSARDLAKA 507

  Fly   255 RELSFDLAL------DVVSSTTDG--------ASNAVTPTPESYARQSQSPLAAAAPSVPVSAAP 305
            ...|.||..      ||.:|.::|        :::.|.|..:....::|..|.|.......||..
  Rat   508 ETRSEDLLCPTQHRGDVQTSQSNGINSVDSIHSTDIVQPCRQRLGHRTQESLTAEDSPGLKSAFT 572

  Fly   306 GPPMGRLVST---------------------SSSSSSL------------LVSESQRL-----QR 332
            ||  |.||||                     ||.:.||            |..:.:||     :|
  Rat   573 GP--GILVSTNRTELRALEPPSPSPSPVKKGSSITWSLPDKIKSPRTVRKLSMKMKRLPEFSRKR 635

  Fly   333 AAAAVYNYRSSMASTEHEYAYIYSEDDEKV---------------YEDLCYVTFQAKAKPEVTTD 382
            .|....:|.:|...|.....:.|.|..:.|               :.|....:..:..|..:.:.
  Rat   636 GARGALHYTNSPDRTPPLSKWYYGEGPQSVLLPSGNPASNVISRYHLDTTVSSQHSYQKKPLGSS 700

  Fly   383 NIACNGTGY------------------DHTNTKEEEVYQDLC--------ALHRTSRSQTASSTS 421
            ...|.| ||                  :|...|..|.....|        |....|.|.....:.
  Rat   701 RYPCKG-GYLSDGDSPELRTRSSKHGSEHRLGKGREAVPSGCSKNEIDVGAFRHYSFSDQPKCSQ 764

  Fly   422 F--------------------EQRDYVIRELIDTESNYLDVLTALKTKFMGPLERHL-----NQD 461
            :                    :.:|......:|:.:.....|...:|.|: .|:...     |..
  Rat   765 YISGLMSVHFYGAEGLKPPRIDSKDVFCAIQVDSVNKARTALLTCRTTFL-DLDHTFNIEIENAQ 828

  Fly   462 ELRLIF------PRIRELVDIH-TKFLDKL-RESLTPNAKVKMAQVFLDFREP-FLIYGEFC--- 514
            .|:|:.      || |..|..| |..|..| |.:.|....||:        || .|||.:..   
  Rat   829 HLKLVVFSWEPTPR-RNRVCCHGTVVLPALFRVTRTHQLAVKL--------EPRGLIYVKVTLME 884

  Fly   515 --------------SLLLGAIDYLADVCKKNQ--IIDQLVQKC---------------------- 541
                          |::.| :|....|.|:|.  ::..|:|||                      
  Rat   885 QWENSLHGLDKNRESVMFG-VDIQKVVEKENAGLMVPLLIQKCIMEIEKRGCQVVGLYRLCGSAA 948

  Fly   542 ---------ER-------------DYNVGKLQLRDIL-SVPMQRILK--YHLLLDKLVKETSPLH 581
                     |:             |.||....|:|.| .:|...|.|  |..:||.:||  |||.
  Rat   949 VKKELREAFEKDSKTVGLCEDQYPDINVITGVLKDYLRELPSPLITKQLYQAVLDAMVK--SPLK 1011

  Fly   582 DDYRSLERA---KEAMIDVSQYINEVKRDS-----DHLVIIQKVKD---------SICDIHLLQN 629
            ......|..   ....:|:...:.:|::.:     |||.::....:         ::|       
  Rat  1012 MSSNGCENESSDSRFTVDLLNCLPDVEKATLKMLLDHLKLVASYHEVNKMTCQNLAVC------- 1069

  Fly   630 GNGSDLLQYGRLLLDGELHIKAHEDQ----KTKLRYAFVFDKILIMVKALH 676
                    :|.:||:.......|.::    ..:|..|..|.|   .::.||
  Rat  1070 --------FGPVLLNQRQETSTHNNRVFSDSEELASALDFKK---HIEVLH 1109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VavNP_001097030.1 CH 20..132 CDD:278723
RhoGEF 428..603 CDD:279015 55/257 (21%)
PH_Vav 624..753 CDD:269930 10/57 (18%)
PH 641..749 CDD:278594 9/40 (23%)
C1_1 761..804 CDD:278556
SH2_Vav_family 824..934 CDD:198193
SH3 940..993 CDD:302595
Syde2XP_017446301.2 PHA03247 <115..324 CDD:223021
C2 767..882 CDD:417471 26/124 (21%)
RhoGAP 902..1116 CDD:413382 44/229 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.