DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vav and RASGRP3

DIOPT Version :9

Sequence 1:NP_001097030.1 Gene:Vav / 32920 FlyBaseID:FBgn0040068 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_001132960.1 Gene:RASGRP3 / 25780 HGNCID:14545 Length:690 Species:Homo sapiens


Alignment Length:627 Identity:122/627 - (19%)
Similarity:212/627 - (33%) Gaps:221/627 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   400 EVYQDLCALHRTSRSQTAS----STSFEQRDYVIR---------ELIDTESNYLDVLTALKTKFM 451
            |:.:.|..::|.:..::.:    ...:..|.::::         .||.....:.:|.:.|     
Human    50 ELAEKLLCMYRNATGESCNEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQL----- 109

  Fly   452 GPLERHLNQDELRLIFPRIRELVDIHT-KFLDKLRESLTPNAKVK---MAQVFLDFREP------ 506
             ..|:|::             |:||.: ...|.:|. :|...||.   .|.:..|..||      
Human   110 -GYEKHVS-------------LIDISSIPSYDWMRR-VTQRKKVSKKGKACLLFDHLEPIELAEH 159

  Fly   507 --FLIYGEFCSLLLGAIDYLADV---CKKNQIIDQLVQKCERDYN-VGKLQLRDILS--VPMQR- 562
              ||.:..|  ..:...||.:.|   |.:|   :..:::....:| :.|.....:||  .|.|| 
Human   160 LTFLEHKSF--RRISFTDYQSYVIHGCLEN---NPTLERSIALFNGISKWVQLMVLSKPTPQQRA 219

  Fly   563 --ILKYHLLLDKL--VKETSPLHD-----DYRSLERAKEAMIDVSQYINEVKRDSDHLVIIQKVK 618
              |.|:..:..||  :|..:.|..     .:.|:.|.||....:|..:.:...:...||      
Human   220 EVITKFINVAKKLLQLKNFNTLMAVVGGLSHSSISRLKETHSHLSSEVTKNWNEMTELV------ 278

  Fly   619 DSICDIHLLQNGNGSDLLQYGRLLLDGE--------LHIK----AH-------EDQKTKL----R 660
                    ..|||   ...|.:...|.:        :|:|    .|       |:.|..:    :
Human   279 --------SSNGN---YCNYRKAFADCDGFKIPILGVHLKDLIAVHVIFPDWTEENKVNIVKMHQ 332

  Fly   661 YAFVFDKILIMVKALHIKTGDMQYTYRDSHNLADYRVEQSHSRRTIGRDTRFKYQLLLARKSGKT 725
            .:....:::.:..|.|....:|     |..||....::..|:     .|..:|..|:|..::.|:
Human   333 LSVTLSELVSLQNASHHLEPNM-----DLINLLTLSLDLYHT-----EDDIYKLSLVLEPRNSKS 387

  Fly   726 AFT-------------------------------------LYLKSEHERDKWRKALTEAMESL-- 751
            ..|                                     ::...:|:.|.:  ...|..||:  
Human   388 QPTSPTTPNKPVVPLEWALGVMPKPDPTVINKHIRKLVESVFRNYDHDHDGY--ISQEDFESIAA 450

  Fly   752 -------------EPPGCQSTD----------------------HKMEIYTFDAPTTCRHCSKFL 781
                         :..|..|.|                      |..:..|:..||.|.||:.||
Human   451 NFPFLDSFCVLDKDQDGLISKDEMMAYFLRAKSQLHCKMGPGFIHNFQEMTYLKPTFCEHCAGFL 515

  Fly   782 KGRIHQGYRCKVCQISVHKGC----ISSTGRCKQNPV------SVP-----PPVCDRQLSEFNWF 831
            .|.|.|||:||.|..:.||.|    :.:..|..:.|.      |:|     ||..| ::.||   
Human   516 WGIIKQGYKCKDCGANCHKQCKDLLVLACRRFARAPSLSSGHGSLPGSPSLPPAQD-EVFEF--- 576

  Fly   832 AGNMDRETAAHR-LENRRI-----GTYLLRVRPQGPSTAHET 867
                ...||.|| |::|.|     .:..:.||.|..:|:..|
Human   577 ----PGVTAGHRDLDSRAITLVTGSSRKISVRLQRATTSQAT 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VavNP_001097030.1 CH 20..132 CDD:278723
RhoGEF 428..603 CDD:279015 44/211 (21%)
PH_Vav 624..753 CDD:269930 28/203 (14%)
PH 641..749 CDD:278594 22/167 (13%)
C1_1 761..804 CDD:278556 20/46 (43%)
SH2_Vav_family 824..934 CDD:198193 14/50 (28%)
SH3 940..993 CDD:302595
RASGRP3NP_001132960.1 REM 11..126 CDD:100121 13/94 (14%)
RasGEF 148..384 CDD:214539 52/267 (19%)
EF-hand_7 428..478 CDD:316058 8/51 (16%)
C1 495..544 CDD:237996 20/48 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 667..690
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.