DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vav and pex13

DIOPT Version :9

Sequence 1:NP_001097030.1 Gene:Vav / 32920 FlyBaseID:FBgn0040068 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_593611.1 Gene:pex13 / 2543046 PomBaseID:SPAC3C7.10 Length:288 Species:Schizosaccharomyces pombe


Alignment Length:133 Identity:30/133 - (22%)
Similarity:57/133 - (42%) Gaps:25/133 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   881 KHMKINQENSGDSMLYCLSSRRHFKTIVELVSY-----------YERNDLGENFAGLNQSLQWP- 933
            ||.||::.||.:..::......|..:|..:||.           |....|.:|.....:.:|.. 
pombe   152 KHSKIDEMNSQEYDVFEKEEGNHKNSIYSIVSSLAIILGLVGLPYAIIRLFKNIYEKEKQIQQAK 216

  Fly   934 -YKEV----IATALYDYEPKAGSNQLQLRTDCQVLVIGKDGDSKG----WWRG--KIGDTVGYFP 987
             .|::    ...|.|::..:....::.|:....:.::.|. |::|    ||:|  :.|:| |:||
pombe   217 IRKKIDSLEFCKADYEFMSRDPGVEMSLKKGDIIAILSKT-DTQGNPCEWWQGRKRSGET-GWFP 279

  Fly   988 KEY 990
            ..|
pombe   280 SNY 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VavNP_001097030.1 CH 20..132 CDD:278723
RhoGEF 428..603 CDD:279015
PH_Vav 624..753 CDD:269930
PH 641..749 CDD:278594
C1_1 761..804 CDD:278556
SH2_Vav_family 824..934 CDD:198193 14/65 (22%)
SH3 940..993 CDD:302595 15/57 (26%)
pex13NP_593611.1 Peroxin-13_N 86..202 CDD:282008 11/49 (22%)
SH3_Pex13p_fungal 226..285 CDD:212705 15/59 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.