DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vav and scd1

DIOPT Version :9

Sequence 1:NP_001097030.1 Gene:Vav / 32920 FlyBaseID:FBgn0040068 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_594221.1 Gene:scd1 / 2542337 PomBaseID:SPAC16E8.09 Length:872 Species:Schizosaccharomyces pombe


Alignment Length:572 Identity:126/572 - (22%)
Similarity:229/572 - (40%) Gaps:135/572 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 TFQAKAKPEVTTDNIACNGTGYDHTNTKEEEVYQDLCALHRTSRSQTASSTSFEQRDYVIRELID 434
            |.::.:.|..:||:....||               |.:|..:.|..||             ||.:
pombe   202 TTKSSSTPSPSTDDNVPTGT---------------LNSLIASGRRVTA-------------ELYE 238

  Fly   435 TESNYLDVLTALKTKFMGPLERH--LNQDELRLIFPRIRELVDIHTKFLDKLRESLT-PNAKVKM 496
            ||..|:..|..| :.:|..|::.  |:||.:..||..:.|::|...:||..|..:|: |..:.::
pombe   239 TELKYIQDLEYL-SNYMVILQQKQILSQDTILSIFTNLNEILDFQRRFLVGLEMNLSLPVEEQRL 302

  Fly   497 AQVFLDFREPFLIYGEFCSLLLGAIDYLADVCKKNQIIDQLVQKCERDYNVGKLQLRDILSVPMQ 561
            ..:|:...|.|.:|..||:....|...:.|  .:||:: ::....|..|     :|..:|..|:|
pombe   303 GALFIALEEGFSVYQVFCTNFPNAQQLIID--NQNQLL-KVANLLEPSY-----ELPALLIKPIQ 359

  Fly   562 RILKYHLLLDKLVKETSPLHDDYRSLERAKEAMIDVSQYINEVKRDSDHLVIIQKVKDSICDIHL 626
            ||.||.|||::|:|.|...:.....|::....::.|:..:||.:|..::...|.:::..:.|   
pombe   360 RICKYPLLLNQLLKGTPSGYQYEEELKQGMACVVRVANQVNETRRIHENRNAIIELEQRVID--- 421

  Fly   627 LQNGNGSDLLQYGRLLLDGELHI-KAHEDQKTKLRYAFVFDKILIMVKALHIKTGDMQYTYRDSH 690
               ..|..|..:|:||:...::: ||..:::   .:.::|:|||:..|.:               
pombe   422 ---WKGYSLQYFGQLLVWDVVNVCKADIERE---YHVYLFEKILLCCKEM--------------- 465

  Fly   691 NLADYRVEQSHSRRTIGRDTRFKYQLLLARKSGKTAFTLYLKSEHERDKWRKALTEAMESLEPPG 755
                         .|:.|..|    .:...|..|...:|.||.        :.||..:.::.|  
pombe   466 -------------STLKRQAR----SISMNKKTKRLDSLQLKG--------RILTSNITTVVP-- 503

  Fly   756 CQSTDHKMEIYTFDAPTTCRHCSKFLKG-RIHQGYRCKVCQISVHKGCISSTGRCK--------- 810
                :|.|..|....         |.:| ..|:.:..|:.....||..:|...|..         
pombe   504 ----NHHMGSYAIQI---------FWRGDPQHESFILKLRNEESHKLWMSVLNRLLWKNEHGSPK 555

  Fly   811 --QNPVSVPP-PVCDRQLSEFNWFAGNMDRE-TAAHRLENR-----RIGTYLLRVRPQGPSTAHE 866
              ::..|.|. ||.:|..|:.:....:.|.: ...|.|:..     .|.:...:..|...:|:.:
pombe   556 DIRSAASTPANPVYNRSSSQTSKGYNSSDYDLLRTHSLDENVNSPTSISSPSSKSSPFTKTTSKD 620

  Fly   867 TMYALSLKTDDNVIKHMKINQENSGDSMLYCLSSRRHFKTIVELVSYYERND 918
            |..|.:  ||:.....:::|.|.|..:     ||.|..:|...:||    ||
pombe   621 TKSATT--TDERPSDFIRLNSEESVGT-----SSLRTSQTTSTIVS----ND 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VavNP_001097030.1 CH 20..132 CDD:278723
RhoGEF 428..603 CDD:279015 49/177 (28%)
PH_Vav 624..753 CDD:269930 22/129 (17%)
PH 641..749 CDD:278594 19/108 (18%)
C1_1 761..804 CDD:278556 9/43 (21%)
SH2_Vav_family 824..934 CDD:198193 22/101 (22%)
SH3 940..993 CDD:302595
scd1NP_594221.1 CDC24 105..194 CDD:283938
RhoGEF 232..401 CDD:279015 51/190 (27%)
PH_Scd1 404..546 CDD:270066 37/205 (18%)
PB1 775..848 CDD:214770
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.