DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vav and STAC3

DIOPT Version :9

Sequence 1:NP_001097030.1 Gene:Vav / 32920 FlyBaseID:FBgn0040068 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_659501.1 Gene:STAC3 / 246329 HGNCID:28423 Length:364 Species:Homo sapiens


Alignment Length:318 Identity:68/318 - (21%)
Similarity:107/318 - (33%) Gaps:122/318 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   723 GKTAFTLYLKSEHERDKWRKALTEAMESLEPPG-CQSTDHKMEIYTFDAPTTCRHCSKFLKGRIH 786
            |...:.:|.:.|.|.::      |.....|||. .....||.:.:.|..|..|..|::.:.....
Human    57 GGPIYYIYEEEEEEEEE------EEEPPPEPPKLVNDKP
HKFKDHFFKKPKFCDVCARMIVLNNK 115

  Fly   787 QGYRCKVCQISVHKGCIS--STGRCKQNPVSVPP--------PV-------CDRQLS-------- 826
            .|.|||.|:.::|:.|.|  ...||..   .:||        |:       |.:.||        
Human   116 FGLRCKNCKTNIHEHCQSYV
EMQRCFG---KIPPGFHRAYSSPLYSNQQYACVKDLSAANRNDPV 177

  Fly   827 ---------------------EFNWFAGNMDRETAAHRLENRR--IGTYLLRVRPQGPSTAHETM 868
                                 :.|..|..|:.|..:.|.|..:  .|      .|:|...|.:  
Human   178 FETLRTGVIMANKERKKGQADKKNPVAAMMEEEPESARPEEGKPQDG------NPEGDKKAEK-- 234

  Fly   869 YALSLKTDDNVIKHMKINQENSGDSMLYCLSSRRHFKTIVELVSYYERNDLGENFAGLNQSLQWP 933
                 ||.|:..|.....|.:      |.::..| ||.:       |::||              
Human   235 -----KTPDDKHKQPGFQQSH------YFVALYR-FKAL-------EKDDL-------------- 266

  Fly   934 YKEVIATALYDYEPKAGSNQLQLRTDCQVLVIGKDGDSKGWWRGKIGDTVGYFPKEYV 991
                      |:.|..           ::.||  |..::.|||||||:.||:||..::
Human   267 ----------DFPPGE-----------KITVI--DDSNEEWWRGKIGEKVGFFPPNFI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VavNP_001097030.1 CH 20..132 CDD:278723
RhoGEF 428..603 CDD:279015
PH_Vav 624..753 CDD:269930 5/29 (17%)
PH 641..749 CDD:278594 5/25 (20%)
C1_1 761..804 CDD:278556 13/42 (31%)
SH2_Vav_family 824..934 CDD:198193 24/140 (17%)
SH3 940..993 CDD:302595 16/52 (31%)
STAC3NP_659501.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89 8/37 (22%)
C1_1 90..135 CDD:278556 14/44 (32%)
STAC2_u1 147..>239 CDD:293269 16/104 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..244 14/67 (21%)
SH3_Stac3_1 251..303 CDD:212919 23/96 (24%)
SH3_Stac_2 310..360 CDD:212768
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.